Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in energy metabolism. The branched-chain alpha-keto acid dehydrogenase complex catalyzes the overall conversion of branched chain alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).
ProductProbable branched-chain keto acid dehydrogenase E1 component, alpha subunit BkdA
CommentsRv2497c, (MTCY07A7.03c), len: 367 aa. Probable bkdA, branched-chain keto acid dehydrogenase E1 component, alpha subunit, similar to many e.g. Q9Y8I5|PDHA from Halobacterium volcanii (Haloferax volcanii) (368 aa) FASTA scores: opt: 961, E(): 1.3e-52, (45.6% identity in 351 aa overlap); BAB40585 from Bacillus sp. UTB2301 (356 aa) FASTA scores: opt: 947, E(): 9.1e-52, (43.1% identity in 355 aa overlap); Q9KG99|BH0213 from Bacillus halodurans (367 aa), FASTA scores: opt: 896, E(): 1.4e-48, (42.65% identity in 340 aa overlap); etc. Also similar to several putative branched-chain alpha keto acid dehydrogenases E1, beta subunit, alternate name : 2-oxoisovalerate dehydrogenase, e.g. Q53592|BKDA from Streptomyces avermitilis (381 aa), FASTA scores: opt: 980, E(): 8.5e-54, (45.65% identity in 370 aa overlap); etc. Previously known as pdhA.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28109932812096-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2497c|bkdA
MGEGSRRPSGMLMSVDLEPVQLVGPDGTPTAERRYHRDLPEETLRWLYEMMVVTRELDTEFVNLQRQGELALYTPCRGQEAAQVGAAACLRKTDWLFPQYRELGVYLVRGIPPGHVGVAWRGTWHGGLQFTTKCCAPMSVPIGTQTLHAVGAAMAAQRLDEDSVTVAFLGDGATSEGDVHEALNFAAVFTTPCVFYVQNNQWAISMPVSRQTAAPSIAHKAIGYGMPGIRVDGNDVLACYAVMAEAAARARAGDGPTLIEAVTYRLGPHTTADDPTRYRSQEEVDRWATLDPIPRYRTYLQDQGLWSQRLEEQVTARAKHVRSELRDAVFDAPDFDVDEVFTTVYAEITPGLQAQREQLRAELARTD
      
Bibliography