Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in transcriptional mechanism.
ProductProbable transcriptional regulatory protein (probably TetR-family)
CommentsRv2506, (MTCY07A7.12), len: 215 aa. Probable transcriptional regulator, TetR family, similar to many others e.g. Q9L078|SCC105.06c putative TetR-family regulatory protein from Streptomyces coelicolor (208 aa), FASTA scores: opt: 333, E(): 1.5e-14, (48.75% identity in 197 aa overlap); Q9X7X6|SC6A5.30c putative regulatory protein from Streptomyces coelicolor (404 aa), FASTA scores: opt: 267, E(): 4.8e-10, (30.45% identity in 207 aa overlap) (similarity only with C-terminus for this one); Q9FBI8|SCP8.33c putative TetR-family transcriptional regulator from Streptomyces coelicolor (213 aa), FASTA scores: opt: 239, E(): 1.8e-08, (29.9% identity in 184 aa overlap); etc. Also similar to transcriptional regulatory proteins from Mycobacterium tuberculosis e.g. O05858|Rv3208|MTCY07D11.18c (228 aa), FASTA scores: opt: 218, E(): 4.4e-07, (30.35% identity in 191 aa overlap); C-terminus of P95251|Rv1963c|MTV051.01c|MTCY09F9.01 (406 aa), FASTA scores: opt: 238, E(): 3.6e-08, (28.25% identity in 177 aa overlap); P96839|Rv3557c|MTCY06G11.04c (200 aa), FASTA scores: opt: 215, E(): 6.2e-07, (38.25% identity in 148 aa overlap); etc. Equivalent to AAK46885 from Mycobacterium tuberculosis strain CDC1551 (231 aa) but shorter 16 aa. Contains probable helix-turn-helix motif at aa 46-67, (Score 1660, +4.84 SD). Belongs to the TetR/AcrR family of transcriptional regulators.
Functional categoryRegulatory proteins
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate and membrane protein fraction of M. tuberculosis H37Rv but not whole cell lysates (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28217122822359+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2506|Rv2506
VTASAPDGRPGQPEATNRRSQLKSDRRFQLLAAAERLFAERGFLAVRLEDIGAAAGVSGPAIYRHFPNKESLLVELLVGVSARLLAGARDVTTRSANLAAALDGLIEFHLDFALGEADLIRIQDRDLAHLPAVAERQVRKAQRQYVEVWVGVLRELNPGLAEADARLMAHAVFGLLNSTPHSMKAADSKPARTVRARAVLRAMTVAALSAADRCL