Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionBiosynthesis of fatty acids and lipids. Transfers the 4'-phosphopantetheine moiety from coenzyme A to a SER of acyl-carrier protein. Catalyzes the formation of holo-ACP, which mediates the transfer of acyl fatty-acid intermediates during the biosynthesis of fatty acids and lipids [catalytic activity: CoA + APO-[acyl-carrier protein] = adenosine 3',5'-bisphosphate + holo-[acyl-carrier protein] ].
Productholo-[acyl-carrier protein] synthase AcpS (holo-ACP synthase) (CoA:APO-[ACP]pantetheinephosphotransferase) (CoA:APO-[acyl-carrier protein]pantetheinephosphotransferase)
CommentsRv2523c, (MT2599, MTV009.08c), len: 130 aa. AcpS, holo-[Acyl Carrier Protein] synthase (see citation below), equivalent to Q9X7E3|ACPS_MYCLE|ML1192|MLCB458.07 holo-[acyl-carrier protein] synthase from Mycobacterium leprae (130 aa), FASTA scores: opt: 732, E(): 5.5e-42, (87.5% identity in 128 aa overlap). Also similar to others e.g. O86785|ACPS_STRCO|SC6G4.22c from Streptomyces coelicolor (123 aa), FASTA scores: opt: 204, E(): 6.6e-07, (36.7% identity in 139 aa overlap); Q9KPB6|VC2457 from Vibrio cholerae (126 aa), FASTA scores: opt: 163, E(): 0.00036, (32.55% identity in 129 aa overlap); P24224|ACPS_ECOLI|DPJ|B2563 from Escherichia coli strain K12 (125 aa), FASTA scores: opt: 151, E(): 0.0022, (30.55% identity in 131 aa overlap); etc. Belongs to the ACPS family. Acts on fas-I enzymes in C. glutamicum (See Chalut et al., 2006).
Functional categoryLipid metabolism
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene in M. smegmatis; C. glutamicum mutant is auxotrophic for oleic acid and produces only one detectable corynomycolate (See Chalut et al., 2006).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28395382839930-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2523c|acpS
MGIVGVGIDLVSIPDFAEQVDQPGTVFAETFTPGERRDASDKSSSAARHLAARWAAKEAVIKAWSGSRFAQRPVLPEDIHRDIEVVTDMWGRPRVRLTGAIAEYLADVTIHVSLTHEGDTAAAVAILEAP