Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in peptide bond synthesis. Stimulate efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.
ProductProbable elongation factor P Efp
CommentsRv2534c, (MTCY159.22), len: 187 aa. Probable efp, elongation factor P, equivalent to Q9CCS0|EFP|ML0522 elongation factor P from Mycobacterium leprae (187 aa), FASTA scores: opt: 1158, E(): 2.1e-67, (94.1% identity in 186 aa overlap). Also highly similar to many e.g. Q45288|EFP_CORGL from Corynebacterium glutamicum (Brevibacterium flavum) (187 aa), FASTA scores: opt: 843, E(): 3.4e-47, (69.5% identity in 187 aa overlap); Q9KXQ9|EFP from Streptomyces coelicolor (188 aa), FASTA scores: opt: 833, E(): 1.5e-46, (67.0% identity in 188 aa overlap); P49778|EFP_BACSU from Bacillus subtilis (185 aa), FASTA scores: opt: 607, E(): 4.6e-32, (47.8% identity in 182 aa overlap); P33398|EFP_ECOLI|B4147 from Escherichia coli strain K12 (187 aa), FASTA scores: opt: 503, E(): 1.8e-27, (42.3% identity in 182 aa overlap); etc. Belongs to the elongation factor P family.
Functional categoryInformation pathways
ProteomicsThe product of this CDS corresponds to spot 3_297 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany, and spot 2534c identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (see proteomics citations). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h and 96h of starvation (see Betts et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28587272859290-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2534c|efp
VATTADFKNGLVLVIDGQLWTITEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKVDTATVDRRDTTYLYRDGSDFVFMDSQDYEQHPLPEALVGDAARFLLEGMPVQVAFHNGVPLYIELPVTVELEVTHTEPGLQGDRSSAGTKPATLQTGAQINVPLFINTGDKLKVDSRDGSYLGRVNA
      
Bibliography