Gene Rv2538c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved at the second step in the biosynthesis of chorismate within the biosynthesis of aromatic amino acids (the shikimate pathway) [catalytic activity: 7-phospho-3-deoxy-arabino-heptulosonate = 3-dehydroquinate + orthophosphate]. |
| Product | 3-dehydroquinate synthase AroB |
| Comments | Rv2538c, (MTCY159.18), len: 362 aa. AroB, 3-dehydroquinate synthase (see citations below), equivalent to Q9CCS4|AROB_MYCLE|ML0518 3-dehydroquinate synthase from Mycobacterium leprae (361 aa), FASTA scores: opt: 2059, E(): 3.3e-117, (87.25% identity in 361 aa overlap). Also highly similar to many e.g. Q9KXQ6|AROB from Streptomyces coelicolor (363 aa), FASTA scores: opt: 1363, E(): 4e-75, (60.05% identity in 358 aa overlap); Q9X5D2|AROB_CORGL from Corynebacterium glutamicum (Brevibacterium flavum) (366 aa), FASTA scores: opt: 1154, E(): 1.7e-62, (50.95% identity in 359 aa overlap); P07639|AROB_ECOLI|B3389 from Escherichia coli strain K12 (362 aa), FASTA scores: opt: 771, E(): 2.4e-39, (40.6% identity in 345 aa overlap); etc. Belongs to the dehydroquinate synthase family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell wall and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by RT-PCR (see Desjardin et al., 2001). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2861588 | 2862676 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2538c|aroB
MTDIGAPVTVQVAVDPPYPVVIGTGLLDELEDLLADRHKVAVVHQPGLAETAEEIRKRLAGKGVDAHRIEIPDAEAGKDLPVVGFIWEVLGRIGIGRKDALVSLGGGAATDVAGFAAATWLRGVSIVHLPTTLLGMVDAAVGGKTGINTDAGKNLVGAFHQPLAVLVDLATLQTLPRDEMICGMAEVVKAGFIADPVILDLIEADPQAALDPAGDVLPELIRRAITVKAEVVAADEKESELREILNYGHTLGHAIERRERYRWRHGAAVSVGLVFAAELARLAGRLDDATAQRHRTILSSLGLPVSYDPDALPQLLEIMAGDKKTRAGVLRFVVLDGLAKPGRMVGPDPGLLVTAYAGVCAP
Bibliography
- Garbe T et al. [1991]. The Mycobacterium tuberculosis shikimate pathway genes: evolutionary relationship between biosynthetic and catabolic 3-dehydroquinases. Sequence
- Skinner MA et al. [1998]. Expression of recombinant aroB-encoded dehydroquinate synthase from pathogenic microorganisms. Secondary Function
- Desjardin LE et al. [2001]. Microaerophilic induction of the alpha-crystallin chaperone protein homologue (hspX) mRNA of Mycobacterium tuberculosis. Secondary Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- de Mendonça JD et al. [2007]. Functional characterization by genetic complementation of aroB-encoded dehydroquinate synthase from Mycobacterium tuberculosis H37Rv and its heterologous expression and purification. Function
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant