Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved at the second step in the biosynthesis of chorismate within the biosynthesis of aromatic amino acids (the shikimate pathway) [catalytic activity: 7-phospho-3-deoxy-arabino-heptulosonate = 3-dehydroquinate + orthophosphate].
Product3-dehydroquinate synthase AroB
CommentsRv2538c, (MTCY159.18), len: 362 aa. AroB, 3-dehydroquinate synthase (see citations below), equivalent to Q9CCS4|AROB_MYCLE|ML0518 3-dehydroquinate synthase from Mycobacterium leprae (361 aa), FASTA scores: opt: 2059, E(): 3.3e-117, (87.25% identity in 361 aa overlap). Also highly similar to many e.g. Q9KXQ6|AROB from Streptomyces coelicolor (363 aa), FASTA scores: opt: 1363, E(): 4e-75, (60.05% identity in 358 aa overlap); Q9X5D2|AROB_CORGL from Corynebacterium glutamicum (Brevibacterium flavum) (366 aa), FASTA scores: opt: 1154, E(): 1.7e-62, (50.95% identity in 359 aa overlap); P07639|AROB_ECOLI|B3389 from Escherichia coli strain K12 (362 aa), FASTA scores: opt: 771, E(): 2.4e-39, (40.6% identity in 345 aa overlap); etc. Belongs to the dehydroquinate synthase family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell wall and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by RT-PCR (see Desjardin et al., 2001).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28615882862676-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2538c|aroB
MTDIGAPVTVQVAVDPPYPVVIGTGLLDELEDLLADRHKVAVVHQPGLAETAEEIRKRLAGKGVDAHRIEIPDAEAGKDLPVVGFIWEVLGRIGIGRKDALVSLGGGAATDVAGFAAATWLRGVSIVHLPTTLLGMVDAAVGGKTGINTDAGKNLVGAFHQPLAVLVDLATLQTLPRDEMICGMAEVVKAGFIADPVILDLIEADPQAALDPAGDVLPELIRRAITVKAEVVAADEKESELREILNYGHTLGHAIERRERYRWRHGAAVSVGLVFAAELARLAGRLDDATAQRHRTILSSLGLPVSYDPDALPQLLEIMAGDKKTRAGVLRFVVLDGLAKPGRMVGPDPGLLVTAYAGVCAP
      
Bibliography