Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible antitoxin VapB19
CommentsRv2547, (MTCY159.09c), len: 85 aa. Possible vapB19, antitoxin, part of toxin-antitoxin (TA) operon with Rv2548 (See Arcus et al., 2005; Pandey and Gerdes, 2005). Similar to others in Mycobacterium tuberculosis e.g. P71666|YD98_MYCTU|Rv1398c|MT1442|MTCY21B4.15c hypothetical 9.4 KDA protein from (85 aa), FASTA scores: opt: 108, E(): 0.33, (37.1% identity in 62 aa overlap); and to CAC45864|SMC01933 conserved hypothetical protein from Rhizobium meliloti (Sinorhizobium meliloti) (71 aa), FASTA scores: opt: 105, E(): 0.46, (28.4% identity in 74 aa overlap); Q97W38|SSO10342 hypothetical protein from Sulfolobus solfataricus (58 aa), FASTA scores: opt: 94, E(): 2.3, (46.95% identity in 49 aa overlap).
Functional category-
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28686062868863+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2547|vapB19
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLARLGLA