Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible toxin VapC19
CommentsRv2548, (MTCY159.08c), len: 125 aa. Possible vapC19, toxin, part of toxin-antitoxin (TA) operon with Rv2547, contains PIN domain (See Arcus et al., 2005; Pandey and Gerdes, 2005). Similarity to others in Mycobacterium tuberculosis e.g. P71665|Rv1397c|MTCY21B4.14c hypothetical 15.0 KDA protein (133 aa), FASTA scores: opt: 265, E(): 7.1e-12, (42.3% identity in 123 aa overlap); and to Q97WY5|SSO1975 hypothetical protein from Sulfolobus solfataricus (125 aa), FASTA scores: opt: 131, E(): 0.018, (30.0% identity in 110 aa overlap); O52285|YLE hypothetical 14.9 KDA protein from Agrobacterium radiobacter (133 aa), FASTA scores: opt: 128, E(): 0.03, (32.8% identity in 125 aa overlap); etc.
Functional category-
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28688602869237+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2548|vapC19
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLARRYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY