Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible toxin VapC20
CommentsRv2549c, (MTCY159.07), len: 131 aa. Possible vapC20, toxin, part of toxin-antitoxin (TA) operon with Rv2550c, contains PIN domain (See Arcus et al., 2005; Pandey and Gerdes, 2005). Conserved hypothetical protein, showing some similarity to P73415|SLL1715 from Synechocystis sp. strain PCC 6803 (157 aa), FASTA scores: opt: 167, E(): 4.2e-05, (29.45% identity in 129 aa overlap); Q9HHY6|VNG6166H from Halobacterium sp. plasmid pNRC200 strain NRC-1 (144 aa), FASTA scores: opt: 133, E(): 0.011, (29.6% identity in 125 aa overlap); and Q9HSU3|VNG0072H from Halobacterium sp. strain NRC-1 (144 aa), FASTA scores: opt: 113, E(): 0.29, (25.75% identity in 136 aa overlap).
Functional category-
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS28697272870122-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2549c|vapC20
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEEQAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE