Gene Rv2549c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible toxin VapC20 |
| Comments | Rv2549c, (MTCY159.07), len: 131 aa. Possible vapC20, toxin, part of toxin-antitoxin (TA) operon with Rv2550c, contains PIN domain (See Arcus et al., 2005; Pandey and Gerdes, 2005). Conserved hypothetical protein, showing some similarity to P73415|SLL1715 from Synechocystis sp. strain PCC 6803 (157 aa), FASTA scores: opt: 167, E(): 4.2e-05, (29.45% identity in 129 aa overlap); Q9HHY6|VNG6166H from Halobacterium sp. plasmid pNRC200 strain NRC-1 (144 aa), FASTA scores: opt: 133, E(): 0.011, (29.6% identity in 125 aa overlap); and Q9HSU3|VNG0072H from Halobacterium sp. strain NRC-1 (144 aa), FASTA scores: opt: 113, E(): 0.29, (25.75% identity in 136 aa overlap). |
| Functional category | - |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2869727 | 2870122 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2549c|vapC20
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEEQAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Pandey DP et al. [2005]. Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Homology
- Gupta A [2009]. Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. Function
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant