Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible toxin VapC41. Contains PIN domain.
CommentsRv2602, (MTCI270A.03c), len: 146 aa. Possible vapC41, toxin, part of toxin-antitoxin (TA) operon with Rv2601A, contains PIN domain, see Arcus et al. 2005. Similar to others in Mycobacterium tuberculosis (strains H37Rv and CDC1551) e.g. O50457|Rv1242|MTV006.14 (143 aa), FASTA scores: opt: 147, E(): 0.0021, (26.25% identity in 141 aa overlap); P95023|Rv2530c|MTCY159.26 (139 aa), FASTA scores: opt: 131, E(): 0.027, (33.35% identity in 135 aa overlap); O53812|Rv0749|MTV041.23 (142 aa), FASTA scores: opt: 125, E(): 0.072, (26.45% identity in 140 aa overlap).
Functional category-
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29303442930784+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2602|vapC41
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDDRIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK