Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCatalyzes the transfer of a free alcohol (inositol) onto CDP-diacylglycerol. The product of this putative ORF seems be essential to mycobacteria [catalytic activity: CDP-diacylglycerol + myo-inositol = CMP + phosphatidyl 1D-myo-inositol]. PgsA1 utilises inositol-phosphate rather than inositol, in contrast to its Eukaryotic ortholog (see Gräve et al. 2019).
ProductPI synthase PgsA1 (phosphatidylinositol synthase) (CDP-diacylglycerol--inositol-3-phosphatidyltransferase)
CommentsRv2612c, (MTCY01A10.21), len: 217 aa. pgsA1 (previously known as pgsA), PI synthase/CDP-diacylglyceride--inositol phosphatidyltransferase, transmembrane protein, equivalent to O07149|MLCL581.16c|PGSA|ML0454 putative phosphatidyltransferase from Mycobacterium leprae (239 aa), FASTA scores: opt: 1141, E(): 4.1e-70, (79.35% identity in 213 aa overlap); and Q9F7Y9|PGSA phosphatidylinositol synthase from Mycobacterium smegmatis (222 aa), FASTA scores: opt: 981, E(): 2.7e-59, (67.3% identity in 217 aa overlap) (see citation below). Also similar to other proteins e.g. Q9L282|SCL2.17c putative membrane transferase from Streptomyces coelicolor (241 aa), FASTA scores: opt: 564, E(): 4.9e-31, (43.4% identity in 212 aa overlap); Q9UYD0|PGSA-like|PAB1041 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase from Pyrococcus abyssi (186 aa), FASTA scores: opt: 264, E(): 8.4e-11, (33.15% identity in 190 aa overlap); Q9HQS2|PGSA|VNG1030G CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase from Halobacterium sp. strain NRC-1 (199 aa), FASTA scores: opt: 249, E(): 9.1e-10, (32.1% identity in 193 aa overlap); etc. Contains PS00379 CDP-alcohol phosphatidyltransferases signature. Belongs to the CDP-alcohol phosphatidyltransferase class-I family. Note that in Mycobacterium smegmatis, the psgA homologue is essential to the survival of the bacteria and seems cannot be compensated by any other enzyme of Mycobacterium smegmatis.
Functional categoryLipid metabolism
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate; enriched in the membrane fraction and predicted N-terminal signal peptide is uncleaved (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantEssential gene (growth defect) for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29399592940612-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2612c|pgsA1
MSKLPFLSRAAFARITTPIARGLLRVGLTPDVVTILGTTASVAGALTLFPMGKLFAGACVVWFFVLFDMLDGAMARERGGGTRFGAVLDATCDRISDGAVFCGLLWWIAFHMRDRPLVIATLICLVTSQVISYIKARAEASGLRGDGGFIERPERLIIVLTGAGVSDFPFVPWPPALSVGMWLLAVASVITCVQRLHTVWTSPGAIDRMAIPGKGDR