Gene Rv2614A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2614A, len: 75 aa. Conserved hypothetical protein. The region from aa 10-35 is similar to part of C-terminal part of several triosephosphate isomerases e.g. P46711|TPIS_MYCLE|TPIA|TPI|ML0572|B1496_C1_127 from Mycobacterium leprae (261 aa), FASTA scores: opt: 112, E(): 0.95, (60.0% identity in 25 aa overlap); and O08408|TPIS_MYCTU|TPIA|TPI|Rv1438|MT1482|MTCY493.16c from Mycobacterium tuberculosis (261 aa), FASTA scores: opt: 104, E(): 3.3, (60.0% identity in 25 aa overlap); P19583|TPIS_CORGL|TPIA|TPI from Corynebacterium glutamicum (Brevibacterium flavum) (259 aa), FASTA scores: opt: 100, E(): 6, (45.45% identity in 33 aa overlap); etc. Triosephosphate isomerases play an important role in several metabolic pathways (catalytic activity: D-glyceraldehyde 3-phosphate = dihydroxy-acetone phosphate). Nucleotide position 2943411 in the genome sequence has been corrected, T:C resulting in L12L. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2943376 | 2943603 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2614A|Rv2614A
VGDRYRAGDRVLYGGSMSPKDVDDLATQQDVDDGQSIERRWTGSGQRRWRRSPPTGRYRSNSQIQVWISGAGRLR
Bibliography
- Niemann S, Koser CU, Gagneux S, Plinke C, Homolka S, Bignell H, Carter RJ, Cheetham RK, Cox A, Gormley NA, Kokko-Gonzales P, Murray LJ, Rigatti R, Smith VP, Arends FP, Cox HS, Smith G and Archer JA [2009]. Genomic diversity among drug sensitive and multidrug resistant isolates of Mycobacterium tuberculosis with identical DNA fingerprints. Sequence
- Ioerger TR et al. [2010]. Variation among genome sequences of H37Rv strains of Mycobacterium tuberculosis from multiple laboratories. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
