Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductConserved hypothetical protein
CommentsRv2614A, len: 75 aa. Conserved hypothetical protein. The region from aa 10-35 is similar to part of C-terminal part of several triosephosphate isomerases e.g. P46711|TPIS_MYCLE|TPIA|TPI|ML0572|B1496_C1_127 from Mycobacterium leprae (261 aa), FASTA scores: opt: 112, E(): 0.95, (60.0% identity in 25 aa overlap); and O08408|TPIS_MYCTU|TPIA|TPI|Rv1438|MT1482|MTCY493.16c from Mycobacterium tuberculosis (261 aa), FASTA scores: opt: 104, E(): 3.3, (60.0% identity in 25 aa overlap); P19583|TPIS_CORGL|TPIA|TPI from Corynebacterium glutamicum (Brevibacterium flavum) (259 aa), FASTA scores: opt: 100, E(): 6, (45.45% identity in 33 aa overlap); etc. Triosephosphate isomerases play an important role in several metabolic pathways (catalytic activity: D-glyceraldehyde 3-phosphate = dihydroxy-acetone phosphate). Nucleotide position 2943411 in the genome sequence has been corrected, T:C resulting in L12L.
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS29433762943603+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2614A|Rv2614A
VGDRYRAGDRVLYGGSMSPKDVDDLATQQDVDDGQSIERRWTGSGQRRWRRSPPTGRYRSNSQIQVWISGAGRLR