Gene Rv2675c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2675c, (MTCY441.44c), len: 250 aa. Conserved hypothetical protein. C-terminus highly similar to Q50010|U1764Z from Mycobacterium leprae (69 aa), FASTA scores: opt: 284, E(): 4.6e-11, (68.25% identity in 63 aa overlap). Shows some similarity with Q9P3V6|SPAC1348.04 (alias Q9P3E7|Q9P7U5) hypothetical 16.6 KDA protein from Schizosaccharomyces pombe (Fission yeast) (145 aa), FASTA scores: opt: 203, E(): 9.5e-06, (33.05% identity in 118 aa overlap); Q9ZSZ7|BMCT methyl chloride transferase from Batis maritima (230 aa), FASTA scores: opt: 197, E(): 3.3e-05, (28.85% identity in 156 aa overlap); P72459|STSG methyltransferase from Streptomyces griseus (253 aa), FASTA scores: opt: 194, E(): 5.5e-05, (24.45% identity in 229 aa overlap); etc. Also similar to various proteins from Mycobacterium tuberculosis e.g. P71805|Rv1377c|MTCY02B12.11c hypothetical 22.8 KDA protein (212 aa), FASTA scores: opt: 431, E(): 8.3e-20, (39.1% identity in 197 aa overlap); O06426|Rv0560c|MTCY25D10.39c hypothetical 25.9 KDA protein (241 aa), FASTA scores: opt: 379, E(): 1.6e-16, (35.95% identity in 178 aa overlap); O69667|Rv3699|MTV025.047 putative methyltransferase (233 aa), FASTA scores: opt: 297, E(): 2e-11, (30.55% identity in 193 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2991184 | 2991936 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2675c|Rv2675c
MTAQFDPADPTRFEEMYRDDRVAHGLPAATPWDIGGPQPVVQQLVALGAIRGEVLDPGTGPGHHAIYYAAKGYAATGIDGSVAAIERARDNARKAGVSVNFQVGDATTLDGLDGRFDTVVDCAFYHTFSTAPELQRCYVRALRRASKPGARLYMFEFGEHNVNGFSMPRSLSEDDFRQVLPVGGWEITYLGTTTYQVNLSVEALELMAARNPDMADQVRCVLERFRAIKPWLVGGRVHAPFWEVHATRVD
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant