Gene Rv2689c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved alanine and valine and glycine rich protein |
| Comments | Rv2689c, (MTCY05A6.10c), len: 405 aa (other less probable starts possible). Conserved ala-, val-, gly-rich protein, similar to O54099|SC10A5.06 hypothetical 49.5 KDA protein from Streptomyces coelicolor (458 aa), FASTA scores: opt: 455, E(): 2.7e-20, (38.35% identity in 417 aa overlap); and shows weak similarity in part with several methyltransferases e.g. Q9X0H9|TM1094 putative RNA methyltransferase from Thermotoga maritima (439 aa), FASTA scores: opt: 306, E(): 3e-11, (25.9% identity in 436 aa overlap); AK79403|CAC1435 S-adenosylmethionine-dependent methyltransferases from Clostridium acetobutylicum (456 aa), FASTA scores: opt: 294, E(): 1.6e-10, (23.4% identity in 449 aa overlap); Q9A8M7|CC1326 RNA methyltransferase from Caulobacter crescentus (415 aa), FASTA scores: opt: 247, E(): 1.1e-07, (28.4% identity in 433 aa overlap); etc. Equivalent to AAK47078 from Mycobacterium tuberculosis strain CDC1551 (434 aa) but shorter 29 aa. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis; transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3005845 | 3007062 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2689c|Rv2689c
VTRAGDDAVNLTLVTGAPANGGSCVAHHEGRVVFVRYALPGERVRARVTAQRGSYWHAEAFEVIDPSPDRIGSLCSIAGADGAGCCDLAFAAPEAARTLKAQVVANQLERLGRHSWQGEAQPLSDAGPTGWRIRVRLDVGADRRPGFHRYHSGELVTDLDCGQLPVGMLDGLVAADWPPEAQLYVALDDDGERHVVCSVRQGPRNRTRTVTNVVEGAYHAHQRVHRRSWRVPVTAFWQAHRDAAAVYSDLIADWAQPAPGMTAWDLYGGAGVFAAVLGEAVGESGRVLTVDTSRLASGAARAALVDLPQVEVVTGSVRRVLAVQPAGADLAVLDPPRSGAGREVVDLLAGAGVPRLIHIGCEAASFARDIGLYRGHGYAVEKIKVFDAFPLTHYVECVALLTRKV
Bibliography
- Fisher MA, Plikaytis BB and Shinnick TM [2002]. Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
