Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in biosynthesis of lysine from aspartate semialdehyde (at the sixth step) [catalytic activity: ll-2,6-diaminoheptanedioate = MESO-diaminoheptanedioate].
ProductProbable diaminopimelate epimerase DapF (DAP epimerase)
CommentsRv2726c, (MTCY154.06c), len: 289 aa. Probable dapF, diaminopimelate epimerase, equivalent to P46814|DAPF_MYCLE|ML0996|B2235_C3_233 diaminopimelate epimerase from Mycobacterium leprae (296 aa), FASTA scores: opt: 1488, E(): 2.1e-83, (76.05% identity in 292 aa overlap). Also highly similar to O69969|DAPF_STRCO|SC4H2.14 from Streptomyces coelicolor (289 aa), FASTA scores: opt: 439, E(): 1.4e-19, (45.6% identity in 296 aa overlap); and similar to many e.g. O29511|DAPF_ARCFU|AF0747 from Archaeoglobus fulgidus (280 aa), FASTA scores: opt: 310, E(): 9.7e-12, (33.8% identity in 296 aa overlap); Q51564|DAPF_PSEAE|PA5278 from Pseudomonas aeruginosa (276 aa), FASTA scores: opt: 272, E(): 2e-09, (30.15% identity in 292 aa overlap); P08885|DAPF_ECOLI|B3809 from Escherichia coli strain K12 (274 aa), FASTA scores: opt: 266, E(): 4.5e-09, (30.4% identity in 296 aa overlap); etc. Belongs to the diaminopimelate epimerase family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30389313039800-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2726c|dapF
MIFAKGHGTQNDFVLLPDVDAELVLTAARVAALCDRRKGLGADGVLRVTTAGAAQAVGVLDSLPEGVRVTDWYMDYRNADGSAAQMCGNGVRVFAHYLRASGLEVRDEFVVGSLAGPRPVTCHHVEAAYADVSVDMGKANRLGAGEAVVGGRRFHGLAVDVGNPHLACVDSQLTVDGLAALDVGAPVSFDGAQFPDGVNVEVLTAPVDGAVWMRVHERGVGETRSCGTGTVAAAVAALAAVGSPTGTLTVHVPGGEVVVTVTDATSFLRGPSVLVARGDLADDWWNAMG