Gene Rv2726c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in biosynthesis of lysine from aspartate semialdehyde (at the sixth step) [catalytic activity: ll-2,6-diaminoheptanedioate = MESO-diaminoheptanedioate]. |
| Product | Probable diaminopimelate epimerase DapF (DAP epimerase) |
| Comments | Rv2726c, (MTCY154.06c), len: 289 aa. Probable dapF, diaminopimelate epimerase, equivalent to P46814|DAPF_MYCLE|ML0996|B2235_C3_233 diaminopimelate epimerase from Mycobacterium leprae (296 aa), FASTA scores: opt: 1488, E(): 2.1e-83, (76.05% identity in 292 aa overlap). Also highly similar to O69969|DAPF_STRCO|SC4H2.14 from Streptomyces coelicolor (289 aa), FASTA scores: opt: 439, E(): 1.4e-19, (45.6% identity in 296 aa overlap); and similar to many e.g. O29511|DAPF_ARCFU|AF0747 from Archaeoglobus fulgidus (280 aa), FASTA scores: opt: 310, E(): 9.7e-12, (33.8% identity in 296 aa overlap); Q51564|DAPF_PSEAE|PA5278 from Pseudomonas aeruginosa (276 aa), FASTA scores: opt: 272, E(): 2e-09, (30.15% identity in 292 aa overlap); P08885|DAPF_ECOLI|B3809 from Escherichia coli strain K12 (274 aa), FASTA scores: opt: 266, E(): 4.5e-09, (30.4% identity in 296 aa overlap); etc. Belongs to the diaminopimelate epimerase family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3038931 | 3039800 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2726c|dapF
MIFAKGHGTQNDFVLLPDVDAELVLTAARVAALCDRRKGLGADGVLRVTTAGAAQAVGVLDSLPEGVRVTDWYMDYRNADGSAAQMCGNGVRVFAHYLRASGLEVRDEFVVGSLAGPRPVTCHHVEAAYADVSVDMGKANRLGAGEAVVGGRRFHGLAVDVGNPHLACVDSQLTVDGLAALDVGAPVSFDGAQFPDGVNVEVLTAPVDGAVWMRVHERGVGETRSCGTGTVAAAVAALAAVGSPTGTLTVHVPGGEVVVTVTDATSFLRGPSVLVARGDLADDWWNAMG
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Usha V et al. [2009]. Structure of the diaminopimelate epimerase DapF from Mycobacterium tuberculosis. Structure
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant