Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible toxin VapC21
CommentsRv2757c, (MTV002.22c), len: 138 aa. Possible vapC21, toxin, part of toxin-antitoxin (TA) operon with Rv2758c, contains PIN domain (See Arcus et al., 2005; Pandey and Gerdes, 2005). Similar to several others in M. tuberculosis e.g. P96411|Rv0229c| MTCY08D5.24c (226 aa), FASTA scores: opt: 354, E(): 4.6e-18, (45.25% identity in 137 aa overlap) (N-terminus longer 89 aa); P95007|RV2546|MTCY159.10c (137 aa), FASTA scores: opt: 265, E(): 7.5e-12, (38.5% identity in 135 aa overlap); O07228|Rv0301|MTCY63.06 (141 aa), FASTA scores: opt: 259, E(): 2.1e-11, (42.4% identity in 132 aa overlap); etc.
Functional category-
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30701703070586-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2757c|vapC21
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEIQEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA