Gene Rv2764c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in deoxyribonucleotide biosynthesis. Provides the sole de novo source of dTMP for DANA biosynthesis [catalytic activity: 5,10-methylenetetrahydrofolate + dUMP = dihydrofolate + dTMP]. |
| Product | Probable thymidylate synthase ThyA (ts) (TSASE) |
| Comments | Rv2764c, (MTV002.29c), len: 263 aa. Probable thyA, thymidylate synthase, equivalent to Q9CBW0|TYSY_MYCLE|THYA|ML1519 thymidylate synthase from Mycobacterium leprae (266 aa), FASTA scores: opt: 1602, E(): 5.9e-102, (85.5% identity in 262 aa overlap). Also highly similar to many e.g. P00470|TYSY_ECOLI|B2827|Z4144|ECS3684|BAB37107|AAG57938 from Escherichia coli strains K12 and O157:H7 (264 aa), FASTA scores: opt: 1309, E(): 5.9e-82, (66.65% identity in 261 aa overlap); P48464|TYSY_SHIFL|THYA from Shigella flexneri (264 aa), FASTA scores: opt: 1303, E(): 1.5e-81, (65.9% identity in 261 aa overlap); P54081|TYSB_BACAM|THYB|THYBA from Bacillus amyloliquefaciens (264 aa), FASTA scores: opt: 1235, E(): 6.7e-77, (66.65% identity in 261 aa overlap); etc. Contains PS00091 Thymidylate synthase active site. Belongs to the thymidylate synthase family. |
| Functional category | Intermediary metabolism and respiration |
| Transcriptomics | mRNA identified by DNA microarray analysis and possibly down-regulated by hspR|Rv0353 (see Stewart et al., 2002). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3073680 | 3074471 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2764c|thyA
VTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFEYTYEDIVVKNYDPHPAIKAPVAV
Bibliography
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Regulation
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
