Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in deoxyribonucleotide biosynthesis. Provides the sole de novo source of dTMP for DANA biosynthesis [catalytic activity: 5,10-methylenetetrahydrofolate + dUMP = dihydrofolate + dTMP].
ProductProbable thymidylate synthase ThyA (ts) (TSASE)
CommentsRv2764c, (MTV002.29c), len: 263 aa. Probable thyA, thymidylate synthase, equivalent to Q9CBW0|TYSY_MYCLE|THYA|ML1519 thymidylate synthase from Mycobacterium leprae (266 aa), FASTA scores: opt: 1602, E(): 5.9e-102, (85.5% identity in 262 aa overlap). Also highly similar to many e.g. P00470|TYSY_ECOLI|B2827|Z4144|ECS3684|BAB37107|AAG57938 from Escherichia coli strains K12 and O157:H7 (264 aa), FASTA scores: opt: 1309, E(): 5.9e-82, (66.65% identity in 261 aa overlap); P48464|TYSY_SHIFL|THYA from Shigella flexneri (264 aa), FASTA scores: opt: 1303, E(): 1.5e-81, (65.9% identity in 261 aa overlap); P54081|TYSB_BACAM|THYB|THYBA from Bacillus amyloliquefaciens (264 aa), FASTA scores: opt: 1235, E(): 6.7e-77, (66.65% identity in 261 aa overlap); etc. Contains PS00091 Thymidylate synthase active site. Belongs to the thymidylate synthase family.
Functional categoryIntermediary metabolism and respiration
TranscriptomicsmRNA identified by DNA microarray analysis and possibly down-regulated by hspR|Rv0353 (see Stewart et al., 2002).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30736803074471-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2764c|thyA
VTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFEYTYEDIVVKNYDPHPAIKAPVAV