Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionMay play a role in cell wall synthesis as L-alanine is an important constituent of the peptidoglycan layer [catalytic activity: L-alanine + H(2)O + NAD(+) = pyruvate + NH(3) + NADH].
ProductSecreted L-alanine dehydrogenase Ald (40 kDa antigen) (TB43)
CommentsRv2780, (MT2850, MTV002.45), len: 371 aa. Ald, secreted L-alanine dehydrogenase (40 kd antigen); equivalent to Q9CBV6|ALD|ML1532 L-alanine dehydrogenase from Mycobacterium leprae (371 aa), FASTA scores: opt: 2081, E(): 4e-115, (85.45% identity in 371 aa overlap). Also highly similar to others e.g. Q9S227|SCI51.13c from Streptomyces coelicolor (371 aa), FASTA scores: opt: 1575, E(): 2.3e-85, (66.05% identity in 371 aa overlap); Q9K827|BH3180 from Bacillus halodurans (371 aa), FASTA scores: opt: 1341, E(): 1.4e-71, (56.45% identity in 372 aa overlap); Q9RT70|DR1895 from Deinococcus radiodurans (390 aa), FASTA scores: opt: 1319, E(): 2.8e-70, (54.2% identity in 371 aa overlap); etc. Contains PS00836 and PS00837 Alanine dehydrogenase & pyridine nucleotide transhydrogenase signature 1 and 2. Predicted possible vaccine candidate (See Zvi et al., 2008).
Functional categoryIntermediary metabolism and respiration
ProteomicsThe product of this CDS corresponds to spots 1_298 and 1_321 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see Jungblut et al., 1999; Mollenkopf et al., 1999; Mattow et al., 2001), and spots 2780 identified in short term culture filtrate and cell wall by proteomics at the Statens Serum Institute (Denmark) (see Rosenkrands et al., 2000a; 2000b). Also identified at the Statens Serum Institute (Denmark) under aerobic and low oxygen conditions (see Rosenkrands et al., 2002). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry and Edman degradation (See Mattow et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see Betts et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30868203087935+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2780|ald
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA
      
Bibliography