Gene Rv2835c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in active transport of Sn-glycerol-3-phosphate across the membrane (import). Responsible for the translocation of the substrate across the membrane. |
| Product | Probable Sn-glycerol-3-phosphate transport integral membrane protein ABC transporter UgpA |
| Comments | Rv2835c, (MTCY1B7.07), len: 303 aa. Probable ugpA, Sn-glycerol-3-phosphate transport integral membrane protein ABC transporter (see citation below), similar to various permeases e.g. Q9RK71|SCF11.19 probable sugar transporter inner membrane protein from Streptomyces coelicolor (316 aa), FASTA scores: opt: 643, E(): 3.1e-35, (38.85% identity in 291 aa overlap); Q9KDY4|BH1077 glycerol-3-phosphate ABC transporter (permease) from Bacillus halodurans (315 aa), FASTA scores: opt: 548, E(): 6.2e-29, (31.5% identity in 295 aa overlap); AAK78407|CAC0427 glycerol-3-phosphate ABC-transporter, permease component from Clostridium acetobutylicum (304 aa), FASTA scores: opt: 538, E(): 2.8e-28, (29.1% identity in 292 aa overlap); etc. Contains PS00062 Aldo/keto reductase family signature 2, and PS00402 Binding-protein-dependent transport systems inner membrane comp signature. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3141311 | 3142222 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2835c|ugpA
MAAPQRARLRSSKERVRDYALFVVLVGPNVALLLLFVYRPLADNIRLSFFDWNVSDPSARFVGLSNYTEWFTRSDTRQIVFNTAVFTGAAVVGSMVLGLALAMLLDRPLRGRNLVRSTVFAPFVISGAAVGLAAQFVFDPHFGLIQDLLRRIGVGVPDFYQDARWALFMVTITYVWKNLGYTFVIYLAALQGVRRDLLEAAEIDGASRWAVFRRVLLPQLRPTTFFLSITVLINSLQVFDVINVMTRGGPEGTGTTTMVYQVYVETFRNFRAGYGATVATIMFLVLLAVTYYQVRVMDRGQRQ
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Parish T, Smith DA, Roberts G, Betts J and Stoker NG [2003]. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Titgemeyer F et al. [2007]. A genomic view of sugar transport in Mycobacterium smegmatis and Mycobacterium tuberculosis. Homology
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
