Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductAntitoxin RelF
CommentsRv2865, (MTV003.11), len: 93 aa. RelF, antitoxin, part of toxin-antitoxin (TA) operon with Rv2866 (See Pandey and Gerdes, 2005), showing weak similarity with P58235|YR54_SYNY3|SSR2754 hypothetical 9.7 KDA protein from Synechocystis sp. strain PCC 6803 (87 aa), FASTA scores: opt: 134, E(): 0.007, (30.65% identity in 75 aa overlap); BAB58570|SAV2408 conserved hypothetical protein from Staphylococcus aureus subsp. aureus Mu50 (83 aa), FASTA scores: opt: 124, E(): 0.037, (27.5% identity in 80 aa overlap). Also similar to Rv1247|MTV006.19c hypothetical 9.8 KDA protein from Mycobacterium tuberculosis (89 aa), FASTA scores: opt: 249, E(): 2.6e-11, (44.2% identity in 86 aa overlap).
Functional category-
OperonRv2865 and Rv2866 are co-transcribed, by RT-PCR (See Korch et al., 2009).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31775373177818+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2865|relF
MRILPISTIKGKLNEFVDAVSSTQDQITITKNGAPAAVLVGADEWESLQETLYWLAQPGIRESIAEADADIASGRTYGEDEIRAEFGVPRRPH
      
Bibliography