Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible antitoxin VapB43
CommentsRv2871, (MTCY274.02), len: 85 aa. Possible vapB43, antitoxin, part of toxin-antitoxin (TA) operon with Rv2872, see Arcus et al. 2005. Similar to others in Mycobacterium tuberculosis strains H37Rv and CDC1551 e.g. O50456|Rv1241|MTV006.13 (86 aa), FASTA scores: opt: 172, E(): 2.9e-05, (37.2% identity in 86 aa overlap); O53811|Rv0748|MTV041.22 (85 aa), FASTA scores: opt: 170, E(): 4e-05, (35.3% identity in 85 aa overlap); etc. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional category-
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31831383183395+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2871|vapB43
VRTTIRIDDELYREVKAKAARSGRTVAAVLEDAVRRGLNPPKPQAAGRYRVQPSGKGGLRPGVDLSSNAALAEAMNDGVSVDAVR