Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible toxin VapC43. Contains PIN domain.
CommentsRv2872, (MTCY274.03), len: 147 aa. Possible vapC43, toxin, part of toxin-antitoxin (TA) operon with Rv2871, contains PIN domain, see Arcus et al. 2005. Similar to others in Mycobacterium tuberculosis strains H37Rv and CDC1551 e.g. O53683|Rv0277c|MTV035.05c (142 aa), FASTA scores: opt: 357, E(): 1.4e-17, (41.45% identity in 140 aa overlap); O53812|Rv0749|MTV041.23 (142 aa), FASTA scores: opt: 350, E(): 4.3e-17, (41.55% identity in 142 aa overlap); etc. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional category-
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31833823183825+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2872|vapC43
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAMRLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL