Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionResponsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another.
ProductRibosome recycling factor Frr (ribosome releasing factor) (RRF)
CommentsRv2882c, (MTCY274.13c), len: 185 aa. Probable frr, ribosome recycling factor, equivalent to O33046|RRF_MYCLE|FRR|ML1590|MLCB250.76 ribosome recycling factor from Mycobacterium leprae (185 aa), FASTA scores: opt: 1063, E(): 2.6e-60, (90.8% identity in 185 aa overlap). Also highly similar to others e.g. O86770|RRF_STRCO|FRR|SC6A9.40c from Streptomyces coelicolor (185 aa), FASTA scores: opt: 783, E(): 1.5e-42, (63.25% identity in 185 aa overlap); P81101|RRF_BACSU|FRR from Bacillus subtilis (184 aa), FASTA scores: opt: 640, E(): 1.7e-33, (51.65% identity in 182 aa overlap); P16174|RRF_ECOLI|FRR|B0172|Z0183|ECS0174 from Escherichia coli strains K12 and O157:H7 (185 aa), FASTA scores: opt: 473, E(): 1.4e-23, (40.2% identity in 184 aa overlap); etc. Belongs to the RRF family.
Functional categoryInformation pathways
ProteomicsThe product of this CDS corresponds to spots 3_365 and 3_283 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany, and spots Frr or 2882c identified in cytosol and short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (see proteomics citations). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry and Edman degradation (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis and possibly down-regulated by hrcA|Rv2374c (see Stewart et al., 2002).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS31916443192201-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2882c|frr
MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQLTEERRRELVKQAKHKGEEAKVSVRNIRRKAMEELHRIRKEGEAGEDEVGRAEKDLDKTTHQYVTQIDELVKHKEGELLEV
      
Bibliography