Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCleavage of N-terminal leader sequences from secreted protein precursors.
ProductProbable signal peptidase I LepB (SPASE I) (leader peptidase I).
CommentsRv2903c, (MTCY274.34c), len: 294 aa. Probable lepB, signal peptidase I (type II membrane protein) (see Braunstein & Belisle 2000), equivalent to O33021|LEP_MYCLE|ML1612|MLCB250.39 probable signal peptidase I from Mycobacterium leprae (289 aa), FASTA scores: opt: 1335, E(): 1.8e-77, (69.75% identity in 301 aa overlap). Also similar to many e.g. O86869|SIPX signal peptidase I from Streptomyces lividans (320 aa), FASTA scores: opt: 474, E(): 1e-22, (43.55% identity in 248 aa overlap); O69884|SIP1|SIPW putative signal peptidase I from Streptomyces coelicolor and Streptomyces lividans (259 aa), FASTA scores: opt: 226, E(): 5e-07, (36.0% identity in 214 aa overlap); P42668|LEP_BACLI|sip signal peptidase I from Bacillus licheniformis (186 aa), FASTA scores: opt: 218, E(): 1.3e-06, (34.5% identity in 194 aa overlap); etc. Contains PS00501 Signal peptidases I serine active site,and PS00761 Signal peptidases I signature 3. Belongs to peptidase family S26; also known as type I leader peptidase family. Conserved in M. tuberculosis, M. leprae, M. bovis and M. avium paratuberculosis; predicted to be essential for in vivo survival and pathogenicity (See Ribeiro-Guimaraes and Pessolani, 2007).
Functional categoryCell wall and cell processes
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h and 96h of starvation (see Betts et al., 2002).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS32129703213854-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2903c|lepB
VTETTDSPSERQPGPAEPELSSRDPDIAGQVFDAAPFDAAPDADSEGDSKAAKTDEPRPAKRSTLREFAVLAVIAVVLYYVMLTFVARPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR
      
Bibliography