Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductHypothetical protein
CommentsRv2929, (MTCY338.18), len: 103 aa. Hypothetical unknown protein; some weak similarity to C-terminal half of P18319|UREG_KLEAE urease accessory protein from klebsiella aerogenes (205 aa), FASTA scores: opt: 99, E(): 1.1, (38.6% identity in 57 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS32429703243281+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2929|Rv2929
MIELSYAPDVAGRRSNWPKGSGVNTWTAIRWTFAEDSPYVGTGLERMASDTHGGGGGRPVTPPPPGMHHLGCSRGVLLISSQRDAGHKTCDPAAGGTLTSVLT