Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv2956, (MTCY349.33c), len: 243 aa. Conserved protein, highly similar to O86299|GSC GSC protein from Mycobacterium avium subsp. silvaticum Mycobacterium avium (240 aa), FASTA scores: opt: 1070, E(): 3.5e-63, (67.5% identity in 240 aa overlap); and O86294|GSC GSC protein from Mycobacterium paratuberculosis (240 aa), FASTA scores: opt: 1070, E(): 3.5e-63, (67.5% identity in 240 aa overlap). Also some similarity with other proteins from other organisms e.g. Q9L727 nodulation protein NOEI from Rhizobium fredii (Sinorhizobium fredii) (241 aa), FASTA scores: opt: 205, E(): 3.5e-06, (27.25% identity in 198 aa overlap); Q9AGG1|LPEA LPEA protein from Rhizobium etli (286 aa), FASTA scores: opt: 201, E(): 7.2e-06, (28.85% identity in 208 aa overlap); P74191|SLL1173 hypothetical 28.0 KDA protein Synechocystis sp. (strain PCC 6803) (244 aa), FASTA scores: opt: 274, E(): 1e-10, (30.65% identity in 225 aa overlap); etc. Also highly similar to others from Mycobacterium tuberculosis e.g. P71792|RV1513|MTCY277.35 hypothetical 26.7 KDA protein (243 aa), FASTA scores: opt: 1105, E(): 1.7e-65, (70.05% identity in 237 aa overlap); etc. Predicted to be an outer membrane protein (See Song et al., 2008). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33086683309399+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2956|Rv2956
VKSLKLARFIARSAAFEVSRRYSERDLKHQFVKQLKSRRVDVVFDVGANSGQYAAGLRRAAYKGRIVSFEPLSGPFTILESKASTDPLWDCRQHALGDSDGTVTINIAGNAGQSSSVLPMLKSHQNAFPPANYVGTQEASIHRLDSVAPEFLGMNGVAFLKVDVQGFEKQVLAGGKSTIDDHCVGMQLELSFLPLYEGGMLIPEALDLVYSLGFTLTGLLPCFIDANNGRMLQADGIFFREDD