Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in leucine biosynthesis (at the second step) [catalytic activity: 3-isopropylmalate = 2-isopropylmaleate + H(2)O (also catalyses 2-isopropylmaleate + H(2)O = 3-hydroxy-4-methyl-3-carboxypentanone)].
ProductProbable 3-isopropylmalate dehydratase (small subunit) LeuD (isopropylmalate isomerase) (alpha-IPM isomerase) (IPMI)
CommentsRv2987c, (MTV012.01c), len: 198 aa. Probable leuD, 3-isopropylmalate dehydratase, small subunit, equivalent to O33124|LEUD_MYCLE 3-isopropylmalate dehydratase small subunit from Mycobacterium leprae (198 aa), FASTA scores: opt: 1155, E(): 4.2e-72, (87.75% identity in 196 aa overlap). Also highly similar to many e.g. O86535|LEUD_STRCO from Streptomyces coelicolor (197 aa), FASTA scores: opt: 765, E(): 2.6e-45, (59.0% identity in 195 aa overlap); P04787|LEUD_SALTY from Salmonella typhimurium (201 aa), FASTA scores: opt: 528, E(): 5.2e-29, (45.05% identity in 191 aa overlap); P30126|LEUD_ECOLI|LEUD|B0071 from Escherichia coli strain K12 (201 aa), FASTA scores: opt: 498, E(): 6e-27, (43.45% identity in 191 aa overlap); etc.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis: up-regulated at high temperatures, and down-regulated after 4h, 24h and 96h of starvation (see citations below). DNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33440333344629-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2987c|leuD
MEAFHTHSGIGVPLRRSNVDTDQIIPAVFLKRVTRTGFEDGLFAGWRSDPAFVLNLSPFDRGSVLVAGPDFGTGSSREHAVWALMDYGFRVVISSRFGDIFRGNAGKAGLLAAEVAQDDVELLWKLIEQSPGLEITANLQDRIITAATVVLPFKIDDHSAWRLLEGLDDIALTLRKLDEIEAFEGACAYWKPRTLPAP
      
Bibliography