Gene Rv3011c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Component of the translational apparatus. Furnishes a means for formation of correctly charged GLN-tRNA(GLN) through the transamidation of misacylated GLU-tRNA(GLN) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-GLU-tRNA(GLN) [catalytic activity: ATP + L-glutamyl-tRNA(GLN) + L-glutamine = ADP + phosphate + L-glutaminyl-tRNA(GLN) + L-glutamate]. |
| Product | Probable glutamyl-tRNA(GLN) amidotransferase (subunit A) GatA (Glu-ADT subunit A) |
| Comments | Rv3011c, (MT3091, MTV012.25c), len: 494 aa. Probable gatA, Glu-tRNA-Gln amidotransferase, subunit A , equivalent to O33105|GATA|ML1702|MLCB637.13 glutamyl-tRNA(GLN) amidotransferase from Mycobacterium leprae (497 aa), FASTA scores: opt: 2839, E(): 3.5e-161, (88.8% identity in 492 aa overlap). Also highly similar to other Glu-tRNA-Gln amidotransferases e.g. Q9Z580|GATA_STRCO from Streptomyces coelicolor (497 aa), FASTA scores: opt: 2231, E(): 4.5e-125, (70.3% identity in 486 aa overlap); P73558|GATA_SYNY3|SLR0877 from Synechocystis sp. strain PCC 6803 (483 aa), FASTA scores: opt: 1593, E(): 3.3e-87, (55.85% identity in 487 aa overlap); O06491|GATA_BACSU glutamyl-tRNA(GLN) amidotransferase from Bacillus subtilis (485 aa), FASTA scores: opt: 1389, E(): 4.3e-75, (51.7% identity in 468 aa overlap); etc. For more information about function, see citation below. Contains PS00017 ATP/GTP-binding site motif A (P-loop). Belongs to the amidase family. Nucleotide position 3370177 in the genome sequence has been corrected, T:G resulting in M420L. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3369950 | 3371434 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3011c|gatA
VTDIIRSDAATLAAKIAIKEVSSAEITRACLDQIEATDETYHAFLHVAADEALAAAAAIDKQVAAGEPLPSALAGVPLALKDVFTTSDMPTTCGSKILEGWRSPYDATLTARLRAAGIPILGKTNMDEFAMGSSTENSAYGPTRNPWNLDRVPGGSGGGSAAALAAFQAPLAIGSDTGGSIRQPAALTATVGVKPTYGTVSRYGLVACASSLDQGGPCARTVLDTALLHQVIAGHDPRDSTSVDAEVPDVVGAARAGAVGDLRGVRVGVVRQLHGGEGYQPGVLASFEAAVEQLTALGAEVSEVDCPHFDHALAAYYLILPSEVSSNLARFDAMRYGLRVGDDGTRSAEEVMAMTRAAGFGPEVKRRIMIGTYALSAGYYDAYYNQAQKVRTLIARDLDAAYRSVDVLVSPTTPTTAFRLGEKVDDPLAMYLFDLCTLPLNLAGHCGMSVPSGLSPDDGLPVGLQIMAPALADDRLYRVGAAYEAARGPLLSAI
Bibliography
- Curnow AW et al. [1997]. Glu-tRNAGln amidotransferase: a novel heterotrimeric enzyme required for correct decoding of glutamine codons during translation. Homolog Product Function Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Niemann S, Koser CU, Gagneux S, Plinke C, Homolka S, Bignell H, Carter RJ, Cheetham RK, Cox A, Gormley NA, Kokko-Gonzales P, Murray LJ, Rigatti R, Smith VP, Arends FP, Cox HS, Smith G and Archer JA [2009]. Genomic diversity among drug sensitive and multidrug resistant isolates of Mycobacterium tuberculosis with identical DNA fingerprints. Sequence
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Ioerger TR et al. [2010]. Variation among genome sequences of H37Rv strains of Mycobacterium tuberculosis from multiple laboratories. Sequence
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant