Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionComponent of the translational apparatus. Furnishes a means for formation of correctly charged GLN-tRNA(GLN) through the transamidation of misacylated GLU-tRNA(GLN) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-GLU-tRNA(GLN) [catalytic activity: ATP + L-glutamyl-tRNA(GLN) + L-glutamine = ADP + phosphate + L-glutaminyl-tRNA(GLN) + L-glutamate].
ProductProbable glutamyl-tRNA(GLN) amidotransferase (subunit A) GatA (Glu-ADT subunit A)
CommentsRv3011c, (MT3091, MTV012.25c), len: 494 aa. Probable gatA, Glu-tRNA-Gln amidotransferase, subunit A , equivalent to O33105|GATA|ML1702|MLCB637.13 glutamyl-tRNA(GLN) amidotransferase from Mycobacterium leprae (497 aa), FASTA scores: opt: 2839, E(): 3.5e-161, (88.8% identity in 492 aa overlap). Also highly similar to other Glu-tRNA-Gln amidotransferases e.g. Q9Z580|GATA_STRCO from Streptomyces coelicolor (497 aa), FASTA scores: opt: 2231, E(): 4.5e-125, (70.3% identity in 486 aa overlap); P73558|GATA_SYNY3|SLR0877 from Synechocystis sp. strain PCC 6803 (483 aa), FASTA scores: opt: 1593, E(): 3.3e-87, (55.85% identity in 487 aa overlap); O06491|GATA_BACSU glutamyl-tRNA(GLN) amidotransferase from Bacillus subtilis (485 aa), FASTA scores: opt: 1389, E(): 4.3e-75, (51.7% identity in 468 aa overlap); etc. For more information about function, see citation below. Contains PS00017 ATP/GTP-binding site motif A (P-loop). Belongs to the amidase family. Nucleotide position 3370177 in the genome sequence has been corrected, T:G resulting in M420L.
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33699503371434-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3011c|gatA
VTDIIRSDAATLAAKIAIKEVSSAEITRACLDQIEATDETYHAFLHVAADEALAAAAAIDKQVAAGEPLPSALAGVPLALKDVFTTSDMPTTCGSKILEGWRSPYDATLTARLRAAGIPILGKTNMDEFAMGSSTENSAYGPTRNPWNLDRVPGGSGGGSAAALAAFQAPLAIGSDTGGSIRQPAALTATVGVKPTYGTVSRYGLVACASSLDQGGPCARTVLDTALLHQVIAGHDPRDSTSVDAEVPDVVGAARAGAVGDLRGVRVGVVRQLHGGEGYQPGVLASFEAAVEQLTALGAEVSEVDCPHFDHALAAYYLILPSEVSSNLARFDAMRYGLRVGDDGTRSAEEVMAMTRAAGFGPEVKRRIMIGTYALSAGYYDAYYNQAQKVRTLIARDLDAAYRSVDVLVSPTTPTTAFRLGEKVDDPLAMYLFDLCTLPLNLAGHCGMSVPSGLSPDDGLPVGLQIMAPALADDRLYRVGAAYEAARGPLLSAI
      
Bibliography