Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductESAT-6 like protein EsxS
CommentsRv3020c, (MTV012.34c), len: 97 aa. EsxS, ESAT-6 like protein. PE-family related protein; distant member of the Mycobacterium tuberculosis PE family, similar to AAK44524|MT0300 PE family protein from M. tuberculosis strain CDC1551 (97 aa), FASTA scores: opt: 564, E(): 5.9e-30, (91.75% identity in 97 aa overlap). Has potential helix-turn-helix motif at positions 14-35. Seems to belong to the ESAT6 family (see Betts et al., 2002). Note that previously known as PE28. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryCell wall and cell processes
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h of starvation (see Betts et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33790363379329-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3020c|esxS
MSLLDAHIPQLIASHTAFAAKAGLMRHTIGQAEQQAMSAQAFHQGESAAAFQGAHARFVAAAAKVNTLLDIAQANLGEAAGTYVAADAAAASSYTGF