Gene Rv3024c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in translation mechanisms [catalytic activity: S-adenosyl-L-methionine + tRNA = S-adenosyl-L-homocysteine + tRNA containing 5-methylaminomethyl-2-thiouridylate]. |
| Product | Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase TrmU |
| Comments | Rv3024c, (MT3108, MTV012.39c), len: 367 aa. Probable trmU, tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase , equivalent to O33099|TRMU_MYCLE|ML1707|MLCB637.07 probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase from Mycobacterium leprae (358 aa), FASTA scores: opt: 2033, E(): 5.5e-116, (85.45% identity in 357 aa overlap). Also highly similar to others e.g. O86583|TRMU_STRCO|SC2A11.22 from Streptomyces coelicolor (376 aa), FASTA scores: opt: 1336, E(): 1e-73, (56.9% identity in 369 aa overlap); BAB49856|MLR2824 from Rhizobium loti (378 aa), FASTA scores: opt: 826, E(): 8.3e-43, (42.35% identity in 359 aa overlap); Q9ZDM1|TRMU_RICPR|RP306 from Rickettsia prowazekii (358 aa), FASTA scores: opt: 800, E(): 3e-41, (40.1% identity in 359 aa overlap); etc. Belongs to the TrmU family. |
| Functional category | Information pathways |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3382785 | 3383888 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3024c|trmU
MKVLAAMSGGVDSSVAAARMVDAGHEVVGVHMALSTAPGTLRTGSRGCCSKEDAADARRVADVLGIPFYVWDFAEKFKEDVINDFVSSYARGETPNPCVRCNQQIKFAALSARAVALGFDTVATGHYARLSGGRLRRAVDRDKDQSYVLAVLTAQQLRHAAFPIGDTPKRQIRAEAARRGLAVANKPDSHDICFIPSGNTKAFLGERIGVRRGVVVDADGVVLASHDGVHGFTIGQRRGLGIAGPGPNGRPRYVTAIDADTATVHVGDVTDLDVQTLTGRAPVFTAGAAPSGPVDCVVQVRAHGETVSAVAELIGDALFVQLHAPLRGVARGQTLVLYRPDPAGDEVLGSATIAGASGLSTGGNPGA
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
