Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionBinds specifically to the SSRA RNA (TMRNA) and is required for stable association of SSRA with ribosomes. Thought to be implicated in the survival of bacterium within macrophages.
ProductProbable SSRA-binding protein SmpB
CommentsRv3100c, (MTCY164.11c), len: 160 aa. Probable smpB, small protein b related to several bacterial small protein b homologs e.g. O32881|SSRP_MYCLE|ML0671|MLCB1779.19c from Mycobacterium leprae (160 aa), FASTA scores: opt: 914, E(): 1.1e-52, (84.9% identity in 159 aa overlap); Q9L1S9|SMPB from Streptomyces coelicolor (159 aa), FASTA scores: opt: 568, E(): 3.3e-30, (55.15% identity in 145 aa overlap); O32230|SSRP_BACSU from Bacillus subtilis (156 aa), FASTA scores: opt: 511, E(): 1.7e-26, (47.05% identity in 153 aa overlap); etc. Belongs to the SSRP family. Conserved in M. tuberculosis, M. leprae, M. bovis and M. avium paratuberculosis; predicted to be essential for in vivo survival and pathogenicity (See Ribeiro-Guimaraes and Pessolani, 2007).
Functional category-
ProteomicsIdentified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantEssential gene (growth defect) for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS34693013469783-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3100c|smpB
VSKSSRGGRQIVASNRKARHNYSIIEVFEAGVALQGTEVKSLREGQASLADSFATIDDGEVWLRNAHIPEYRHGSWTNHEPRRNRKLLLHRRQIDTLVGKIREGNFALVPLSLYFAEGKVKVELALARGKQARDKRQDMARRDAQREVLRELGRRAKGMT