Gene Rv3100c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Binds specifically to the SSRA RNA (TMRNA) and is required for stable association of SSRA with ribosomes. Thought to be implicated in the survival of bacterium within macrophages. |
| Product | Probable SSRA-binding protein SmpB |
| Comments | Rv3100c, (MTCY164.11c), len: 160 aa. Probable smpB, small protein b related to several bacterial small protein b homologs e.g. O32881|SSRP_MYCLE|ML0671|MLCB1779.19c from Mycobacterium leprae (160 aa), FASTA scores: opt: 914, E(): 1.1e-52, (84.9% identity in 159 aa overlap); Q9L1S9|SMPB from Streptomyces coelicolor (159 aa), FASTA scores: opt: 568, E(): 3.3e-30, (55.15% identity in 145 aa overlap); O32230|SSRP_BACSU from Bacillus subtilis (156 aa), FASTA scores: opt: 511, E(): 1.7e-26, (47.05% identity in 153 aa overlap); etc. Belongs to the SSRP family. Conserved in M. tuberculosis, M. leprae, M. bovis and M. avium paratuberculosis; predicted to be essential for in vivo survival and pathogenicity (See Ribeiro-Guimaraes and Pessolani, 2007). |
| Functional category | - |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Essential gene (growth defect) for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3469301 | 3469783 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3100c|smpB
VSKSSRGGRQIVASNRKARHNYSIIEVFEAGVALQGTEVKSLREGQASLADSFATIDDGEVWLRNAHIPEYRHGSWTNHEPRRNRKLLLHRRQIDTLVGKIREGNFALVPLSLYFAEGKVKVELALARGKQARDKRQDMARRDAQREVLRELGRRAKGMT
Bibliography
- Parish T, Smith DA, Roberts G, Betts J and Stoker NG [2003]. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Regulation
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Ribeiro-GuimarĂ£es ML et al. [2007]. Comparative genomics of mycobacterial proteases. Homology
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant