Gene Rv3126c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Hypothetical protein |
| Comments | Rv3126c, (MTCY164.36c), unknown, len: 104 aa. Hypothetical unknown protein. Shortened version of MTCY164.36c, avoiding overlap. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Conserved hypotheticals |
| Transcriptomics | mRNA identified by DNA microarray analysis (gene induced by hypoxia) (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3491808 | 3492122 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3126c|Rv3126c
MVIRFDQIGSLVLSMKSLASLSFQRCLRENSSLVAALDRLDAAVDELSALSFDALTTPERDRARRDRDHHPWSRSRSQLSPRMAHGAVHQCQWPKAVWAVIDNP
Bibliography
- Sherman DR, Voskuil M, Schnappinger D, Liao R, Harrell MI and Schoolnik GK [2001]. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Transcriptome
- Voskuil MI, Schnappinger D, Visconti KC, Harrell MI, Dolganov GM, Sherman DR and Schoolnik GK [2003]. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. Regulon
- Park HD et al. [2003]. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
