Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; involved in cellular metabolism.
ProductProbable monophosphatase
CommentsRv3137, (MTCY03A2.21c), len: 260 aa. Probable monophosphatase, equivalent to O32889|MLCB1779_19|ML0662 putative monophosphatase from Mycobacterium leprae (255 aa), FASTA scores: opt: 1403, E(): 1.2e-81, (81.8% identity in 253 aa overlap). Also similar to Q9K4B1|SC7E4.05c from Streptomyces coelicolor (266 aa), FASTA scores: opt: 969, E(): 3.5e-54, (57.9% identity in 259 aa overlap); Q53743|PUR3 mono-phosphatase from Streptomyces lipmanii (Streptomyces alboniger) (273 aa), FASTA scores: opt: 862, E(): 2.1e-47, (55.25% identity in 257 aa overlap); BAB50023|MLL3039 mono-phosphatase from Rhizobium loti (Mesorhizobium loti) (262 aa), FASTA scores: opt: 448, E(): 3.2e-21, (31.37% identity in 255 aa overlap); etc. Contains inositol monophosphatase family signature 1 (PS00629).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis H37Rv Rv3137 could only be deleted after integration of a second copy of the gene - it could not be deleted if the second copy contained a D86N mutation (position shown in homologs to be important for activity); Rv3137 could not be deleted in the presence of inositol (with or without expression of M. smegmatis porin mspA), or in an ino1|Rv0046c mutant (See Movahedzadeh et al., 2010).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS35033933504175+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3137|Rv3137
VSHDDLMLALALADRADELTRVRFGALDLRIDTKPDLTPVTDADRAVESDVRQTLGRDRPGDGVLGEEFGGSTTFTGRQWIVDPIDGTKNFVRGVPVWASLIALLEDGVPSVGVVSAPALQRRWWAARGRGAFASVDGARPHRLSVSSVAELHSASLSFSSLSGWARPGLRERFIGLTDTVWRVRAYGDFLSYCLVAEGAVDIAAEPQVSVWDLAALDIVVREAGGRLTSLDGVAGPHGGSAVATNGLLHDEVLTRLNAG
      
Bibliography