Gene Rv3249c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Probably involved in a transcriptional mechanism |
| Product | Possible transcriptional regulatory protein (probably TetR-family) |
| Comments | Rv3249c, (MTCY20B11.24c), len: 211 aa. Possible transcriptional regulatory protein, TetR family, with similarity to several e.g. Q9AE61|ALKB1 putative TetR-regulatory from Rhodococcus erythropolis (208 aa), FASTA scores: opt: 503, E(): 7.7e-26, (40.6% identity in 192 aa overlap); CAC37620 putative TetR-regulatory protein from Prauserella rugosa (212 aa), FASTA scores: opt: 246, E(): 4.4e-09, (27.95% identity in 186 aa overlap); Q9K4B0|SC7E4.06 putative TetR-family transcriptional from Streptomyces coelicolor (203 aa), FASTA scores: opt: 224, E(): 1.1e-07, (34.5% identity in 197 aa overlap); Q11063|YC55_MYCTU|Rv1255c|MT1294|MTCY50.27 hypothetical transcriptional regulator from Mycobacterium tuberculosis (202 aa), FASTA scores: opt: 191, E(): 1.6e-05, (28.35% identity in 180 aa overlap); etc. Equivalent to AAK47689 from Mycobacterium tuberculosis strain CDC1551 (230 aa) but shorter 19 aa. Could belong to the TetR/AcrR family of transcriptional regulators. Possible helix-turn helix motif at aa 44-65 (+6.66 SD). |
| Functional category | Regulatory proteins |
| Transcriptomics | mRNA identified by microarray analysis and real-time RT-PCR; transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3629752 | 3630387 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3249c|Rv3249c
VSTPSATVAPVKRIPYAEASRALLRDSVLDAMRDLLLTRDWSAITLSDVARAAGISRQTIYNEFGSRQGLAQGYALRLADRLVDNVHASLDANVGNFYEAFLQGFRSFFAESAADPLVISLLTGVAKPDLLQLITTDSAPIITRASARLAPAFTDTWVATTDNDANVLSRAIVRLCLSYVSMPPEADHDVAADLARLITPFAERHGVINVP
Bibliography
- Fisher MA, Plikaytis BB and Shinnick TM [2002]. Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant