Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3259, (MTV015.04), len: 139 aa. Conserved hypothetical protein, equivalent, but shorter 29 aa, to Q9CCJ9|ML0761 hypothetical protein from Mycobacterium leprae (167 aa), FASTA scores: opt: 846, E(): 2.2e-47, (89.2% identity in 139 aa overlap). C-terminus highly similar to Q9S425 hypothetical 6.0 KDA protein (fragment) from Mycobacterium smegmatis (54 aa), FASTA scores: opt: 275, E(): 2.7e-11, (81.15% identity in 53 aa overlap). Also similar to Q9KZL3|SCE34.12 from Streptomyces coelicolor (117 aa), FASTA scores: opt: 152, E(): 0.004, (34.15% identity in 126 aa overlap). Equivalent to AAK47699 from Mycobacterium tuberculosis strain CDC1551 (175 aa) but shorter 36 aa. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryConserved hypotheticals
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 24h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS36394253639844+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3259|Rv3259
MRGPLLPPTVPGWRSRAERFDMAVLEAYEPIERRWQERVSQLDIAVDEIPRIAAKDPESVQWPPEVIADGPIALARLIPAGVDVRGNATRARIVLFRKPIERRAKDTEELGELLHEILVAQVAIYLDVDPSVIDPTIDD