Gene Rv3279c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | BIRA acts both as a biotin-operon repressor and as the enzyme that synthesizes the corepressor, acetyl-CoA:carbon-dioxide ligase. This protein also activates biotin to form biotinyl-5'-adenylate and transfers the biotin moiety to biotin-accepting proteins [catalytic activity: ATP + biotin + APO-[acetyl-CoA:carbon-dioxide ligase (ADP forming)] = AMP + pyrophosphate + [acetyl-CoA:carbon-dioxide ligase (ADP forming)]]. |
| Product | Possible bifunctional protein BirA: biotin operon repressor + biotin--[acetyl-CoA-carboxylase] synthetase (biotin--protein ligase) |
| Comments | Rv3279c, (MTCY71.19c), len: 266 aa. Possible birA, bifunctional protein: biotin operon repressor and biotin--[acetyl-CoA-carboxylase] synthetase, equivalent to Q9CCL3|BIRA|ML0732 biotin APO-protein ligase from Mycobacterium leprae (274 aa), FASTA scores: opt: 1189, E(): 2.3e-66, (71.2% identity in 271 aa overlap). But as it lacks a BirA h-t-h domain at N-terminus, may simply be biotin apo-protein ligase. Also similar to others e.g. Q9CNX6|BIRA|PM0296 from Pasteurella multocida (312 aa), FASTA scores: opt: 347, E(): 2.7e-14, (32.95% identity in 270 aa overlap); Q9HWC0|BIRA|PA4280 from Pseudomonas aeruginosa (312 aa), FASTA scores: opt: 335, E(): 1.5e-13, (34.2% identity in 272 aa overlap); Q9A6Z0|CC1936 from Caulobacter crescentus (250 aa), FASTA scores: opt: 332, E(): 1.9e-13, (33.6% identity in 238 aa overlap); P06709|BIRA_ECOLI (321 aa), FASTA scores: opt: 314, E(): 3.1e-12, (34.15% identity in 249 aa overlap); etc. Similar with other bacterial BIRA and with eukaryotic biotin APO-protein ligase. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | DNA microarrays detect expression in M. tuberculosis H37Rv in vivo (in BALB/c and SCID mice) but not in vitro (in 7H9 medium) (See Talaat et al., 2004). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3661212 | 3662012 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3279c|birA
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Bibliography
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant