Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
Type-10_signal
FunctionBinds to sigma and blocks its ability to form an RNA polymerase holoenzyme. Regulates negatively SIGF|Rv3286c, and negatively regulated by Rv1365c|RSFA and Rv3687C|RSFB.
ProductAnti-sigma factor RsbW (sigma negative effector)
CommentsRv3287c, (MTCY71.27c), len: 145 aa. RsbW (alternate gene name: usfX), anti-sigma factor (see citations below), similar to Q49667|B1308_F3_89 from Mycobacterium leprae (75 aa), FASTA scores: opt: 308, E(): 2.5e-15, (72.2% identity in 72 aa overlap); Q9R3X8|PRS1|USHX|PRS PRS1 protein (anti-sigma factor) from Streptomyces coelicolor (137 aa), FASTA scores: opt: 184, E(): 3.7e-06, (36.8% identity in 106 aa overlap); O50231 putative sigma-B regulator from Bacillus licheniformis (160 aa), FASTA scores: opt: 122, E(): 0.13, (23.9% identity in 92 aa overlap); and P17904|RSBW_BACSU anti-sigma B factor (sigma-B negative effector RSBW) from Bacillus subtilis (160 aa), FASTA scores: opt: 108, E(): 1.3, (21.25% identity in 127 aa overlap). Equivalent to AAK47729 from Mycobacterium tuberculosis strain CDC1551 (145 aa) but longer 99 aa. Induction by heat shock, salt stress, oxidative stress, glucose limitation and oxygen limitation. N-terminus shortened since first submission (previously 242 aa). Binds ATP, GTP.
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 4h, 24h and 96h of starvation (see Betts et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
-10_signal36695233669528-
-35_signal36695463669549-
CDS36689513669388-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3287c|rsbW
MADSDLPTKGRQRGVRAVELNVAARLENLALLRTLVGAIGTFEDLDFDAVADLRLAVDEVCTRLIRSALPDATLRLVVDPRKDEVVVEASAACDTHDVVAPGSFSWHVLTALADDVQTFHDGRQPDVAGSVFGITLTARRAASSR
      
Bibliography