Gene Rv3287c (usfX)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | -10_signal |
| Function | Binds to sigma and blocks its ability to form an RNA polymerase holoenzyme. Regulates negatively SIGF|Rv3286c, and negatively regulated by Rv1365c|RSFA and Rv3687C|RSFB. |
| Product | Anti-sigma factor RsbW (sigma negative effector) |
| Comments | Rv3287c, (MTCY71.27c), len: 145 aa. RsbW (alternate gene name: usfX), anti-sigma factor (see citations below), similar to Q49667|B1308_F3_89 from Mycobacterium leprae (75 aa), FASTA scores: opt: 308, E(): 2.5e-15, (72.2% identity in 72 aa overlap); Q9R3X8|PRS1|USHX|PRS PRS1 protein (anti-sigma factor) from Streptomyces coelicolor (137 aa), FASTA scores: opt: 184, E(): 3.7e-06, (36.8% identity in 106 aa overlap); O50231 putative sigma-B regulator from Bacillus licheniformis (160 aa), FASTA scores: opt: 122, E(): 0.13, (23.9% identity in 92 aa overlap); and P17904|RSBW_BACSU anti-sigma B factor (sigma-B negative effector RSBW) from Bacillus subtilis (160 aa), FASTA scores: opt: 108, E(): 1.3, (21.25% identity in 127 aa overlap). Equivalent to AAK47729 from Mycobacterium tuberculosis strain CDC1551 (145 aa) but longer 99 aa. Induction by heat shock, salt stress, oxidative stress, glucose limitation and oxygen limitation. N-terminus shortened since first submission (previously 242 aa). Binds ATP, GTP. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 4h, 24h and 96h of starvation (see Betts et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| -10_signal | 3669523 | 3669528 | - |
| -35_signal | 3669546 | 3669549 | - |
| CDS | 3668951 | 3669388 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3287c|rsbW
MADSDLPTKGRQRGVRAVELNVAARLENLALLRTLVGAIGTFEDLDFDAVADLRLAVDEVCTRLIRSALPDATLRLVVDPRKDEVVVEASAACDTHDVVAPGSFSWHVLTALADDVQTFHDGRQPDVAGSVFGITLTARRAASSR
Bibliography
- Gomez JE et al. [1997]. Sigma factors of Mycobacterium tuberculosis. Review
- DeMaio J et al. [1997]. Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons. Secondary
- Beaucher J et al. [2002]. Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Product Function Regulation Mutant
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Beaucher J et al. [2002]. Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Parida BK et al. [2005]. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Biochemistry
- Rodrigue S et al. [2007]. Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. Regulon
- Sachdeva P et al. [2008]. Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. Biochemistry
- Malik SS et al. [2008]. Mycobacterium tuberculosis UsfX (Rv3287c) exhibits novel nucleotide binding and hydrolysis properties. Biochemistry
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant