Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThis enzyme scavenge exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis [catalytic activity: cytidine + H(2)O = uridine + NH(3)].
ProductProbable cytidine deaminase Cdd (cytidine aminohydrolase) (cytidine nucleoside deaminase)
CommentsRv3315c, (MTV016.15c), len: 133 aa. Probable cdd, cytidine deaminase, equivalent to Q9CBD3|CDD|ML2174 cytidine deaminase from Mycobacterium leprae (134 aa), FASTA scores: opt: 516, E(): 5.8e-28, (56.8% identity in 132 aa overlap). Also highly similar to many e.g. Q9AK37|2SCK8.15 from Streptomyces coelicolor (130 aa), FASTA scores: opt: 523, E(): 1.9e-28, (60.0% identity in 130 aa overlap); Q9KD53|CDD|BH1366 from Bacillus halodurans (132 aa), FASTA scores: opt: 305, E(): 9.2e-14, (41.55% identity in 130 aa overlap); P56389|CDD_MOUSE|CDA|CDD from Mus musculus (Mouse) (146 aa), FASTA scores: opt: 287, E(): 1.6e-12, (40.3% identity in 124 aa overlap); P19079|CDD_BACSU (136 aa), FASTA scores: opt: 270, E(): 2.1e-11, (28.6% identity in 127 aa overlap); etc. Contains PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature. Belongs to the cytidine and deoxycytidylate deaminases family. Cofactor: zinc (by similarity).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS37034643703865-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3315c|cdd
MPDVDWNMLRGNATQAAAGAYVPYSRFAVGAAALVDDGRVVTGCNVENVSYGLTLCAECAVVCALHSTGGGRLLALACVDGHGSVLMPCGRCRQVLLEHGGSELLIDHPVRPRRLGDLLPDAFGLDDLPRERR