Gene Rv3315c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | This enzyme scavenge exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis [catalytic activity: cytidine + H(2)O = uridine + NH(3)]. |
| Product | Probable cytidine deaminase Cdd (cytidine aminohydrolase) (cytidine nucleoside deaminase) |
| Comments | Rv3315c, (MTV016.15c), len: 133 aa. Probable cdd, cytidine deaminase, equivalent to Q9CBD3|CDD|ML2174 cytidine deaminase from Mycobacterium leprae (134 aa), FASTA scores: opt: 516, E(): 5.8e-28, (56.8% identity in 132 aa overlap). Also highly similar to many e.g. Q9AK37|2SCK8.15 from Streptomyces coelicolor (130 aa), FASTA scores: opt: 523, E(): 1.9e-28, (60.0% identity in 130 aa overlap); Q9KD53|CDD|BH1366 from Bacillus halodurans (132 aa), FASTA scores: opt: 305, E(): 9.2e-14, (41.55% identity in 130 aa overlap); P56389|CDD_MOUSE|CDA|CDD from Mus musculus (Mouse) (146 aa), FASTA scores: opt: 287, E(): 1.6e-12, (40.3% identity in 124 aa overlap); P19079|CDD_BACSU (136 aa), FASTA scores: opt: 270, E(): 2.1e-11, (28.6% identity in 127 aa overlap); etc. Contains PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature. Belongs to the cytidine and deoxycytidylate deaminases family. Cofactor: zinc (by similarity). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3703464 | 3703865 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3315c|cdd
MPDVDWNMLRGNATQAAAGAYVPYSRFAVGAAALVDDGRVVTGCNVENVSYGLTLCAECAVVCALHSTGGGRLLALACVDGHGSVLMPCGRCRQVLLEHGGSELLIDHPVRPRRLGDLLPDAFGLDDLPRERR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant