Gene Rv3319
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in tricarboxylic acid cycle. Membrane-bound FAD-containing enzyme which is responsible for succinate interconversion [catalytic activity: succinate + acceptor = fumarate + reduced acceptor]. |
| Product | Probable succinate dehydrogenase (iron-sulphur protein subunit) SdhB (succinic dehydrogenase) (fumarate reductase) (fumarate dehydrogenase) (fumaric hydrogenase) |
| Comments | Rv3319, (MTV016.19), len: 263 aa. Probable sdhB, iron-sulphur protein succinate dehydrogenase SdhB subunit , equivalent to Q49916|SDHB|ML0696|L308_F1_28 succinate dehydrogenase iron-sulfur protein from Mycobacterium leprae (264 aa), FASTA scores: opt: 1678, E(): 4.7e-99, (89.8% identity in 264 aa overlap). Also highly similar to other e.g. Q9KZ91|DHSB from Streptomyces coelicolor (257 aa), FASTA scores: opt: 1125, E(): 4.6e-64, (64.1% identity in 262 aa overlap); Q9RVS1|DR0951 from Deinococcus radiodurans (264 aa), FASTA scores: opt: 1014, E(): 5e-57, (57.25% identity in 255 aa overlap); Q9PEF5|XF1073 from Xylella fastidiosa (261 aa), FASTA scores: opt: 681, E(): 5.8e-36, (45.1% identity in 244 aa overlap); P07014|DHSB_ECOLI|SDHB|B0724 from Escherichia coli strain K12 (238 aa), FASTA scores: opt: 657, E(): 1.8e-34, (43.75% identity in 240 aa overlap); etc. Contains PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature. Cofactor: binds three different iron-sulfur clusters: a 2FE-2S, a 3FE-4S and a 4FE-4S. The iron-sulfur centers are similar to those of 'plant-type' 2FE-2S and 'bacterial-type' 4FE-4S ferredoxins. Part of an enzyme complex containing four subunits: a flavoprotein, an iron-sulfur, cytochrome B-556, and an hydrophobic anchor protein. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3706772 | 3707563 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3319|sdhB
MSVEPDVETLDPPLPPVPDGAVMVTVKIARFNPDDPDAFAATGGWQSFRVPCLPSDRLLNLLIYIKGYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMRDLLPKKKGKSLTVTVEPIRGLPVEKDLVVDMEPFFDAYRAIKPYLITSGNPPTRERIQSPTDRARYDDTTKCILCACCTTSCPVFWHEGSYFGPAAIVNAHRFIFDSRDEAAAERLDILNEVDGVWRCRTTFNCTESCPRGIEVTKAIQEVKRALMFTR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant