Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in tricarboxylic acid cycle. Membrane-bound FAD-containing enzyme which is responsible for succinate interconversion [catalytic activity: succinate + acceptor = fumarate + reduced acceptor].
ProductProbable succinate dehydrogenase (iron-sulphur protein subunit) SdhB (succinic dehydrogenase) (fumarate reductase) (fumarate dehydrogenase) (fumaric hydrogenase)
CommentsRv3319, (MTV016.19), len: 263 aa. Probable sdhB, iron-sulphur protein succinate dehydrogenase SdhB subunit , equivalent to Q49916|SDHB|ML0696|L308_F1_28 succinate dehydrogenase iron-sulfur protein from Mycobacterium leprae (264 aa), FASTA scores: opt: 1678, E(): 4.7e-99, (89.8% identity in 264 aa overlap). Also highly similar to other e.g. Q9KZ91|DHSB from Streptomyces coelicolor (257 aa), FASTA scores: opt: 1125, E(): 4.6e-64, (64.1% identity in 262 aa overlap); Q9RVS1|DR0951 from Deinococcus radiodurans (264 aa), FASTA scores: opt: 1014, E(): 5e-57, (57.25% identity in 255 aa overlap); Q9PEF5|XF1073 from Xylella fastidiosa (261 aa), FASTA scores: opt: 681, E(): 5.8e-36, (45.1% identity in 244 aa overlap); P07014|DHSB_ECOLI|SDHB|B0724 from Escherichia coli strain K12 (238 aa), FASTA scores: opt: 657, E(): 1.8e-34, (43.75% identity in 240 aa overlap); etc. Contains PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature. Cofactor: binds three different iron-sulfur clusters: a 2FE-2S, a 3FE-4S and a 4FE-4S. The iron-sulfur centers are similar to those of 'plant-type' 2FE-2S and 'bacterial-type' 4FE-4S ferredoxins. Part of an enzyme complex containing four subunits: a flavoprotein, an iron-sulfur, cytochrome B-556, and an hydrophobic anchor protein.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS37067723707563+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3319|sdhB
MSVEPDVETLDPPLPPVPDGAVMVTVKIARFNPDDPDAFAATGGWQSFRVPCLPSDRLLNLLIYIKGYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMRDLLPKKKGKSLTVTVEPIRGLPVEKDLVVDMEPFFDAYRAIKPYLITSGNPPTRERIQSPTDRARYDDTTKCILCACCTTSCPVFWHEGSYFGPAAIVNAHRFIFDSRDEAAAERLDILNEVDGVWRCRTTFNCTESCPRGIEVTKAIQEVKRALMFTR