Gene Rv3321c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible antitoxin VapB44 |
| Comments | Rv3321c, (MTV016.21c), len: 80 aa. Possible vapB44, antitoxin, part of toxin-antitoxin (TA) operon with Rv0299, see Arcus et al. 2005. Similar to several others in Mycobacterium tuberculosis (strains H37Rv and CDC1551) e.g. AAK48167|MT3800 DNA-binding protein (COPG family) from strain CDC1551 (74 aa), FASTA scores: opt: 142, E(): 0.0016, (48.85% identity in 43 aa overlap); AAK46916|MT2606 hypothetical 8.0 KDA protein from strain CDC1551 (74 aa), FASTA scores: opt: 139, E(): 0.0026, (37.2% identity in 78 aa overlap); O50456|Rv1241|MTV006.13 hypothetical 9.9 KDA protein from strain H37Rv (86 aa), FASTA scores: opt: 134, E(): 0.0066, (39.0% identity in 82 aa overlap); etc. |
| Functional category | - |
| Transcriptomics | mRNA level (identified by real-time quantitative RT-PCR) increased 24 and 72h after cultured macrophages infection (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3708074 | 3708316 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3321c|vapB44
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV
Bibliography
- Dubnau E et al. [2002]. Mycobacterium tuberculosis genes induced during infection of human macrophages. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant