Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible antitoxin VapB44
CommentsRv3321c, (MTV016.21c), len: 80 aa. Possible vapB44, antitoxin, part of toxin-antitoxin (TA) operon with Rv0299, see Arcus et al. 2005. Similar to several others in Mycobacterium tuberculosis (strains H37Rv and CDC1551) e.g. AAK48167|MT3800 DNA-binding protein (COPG family) from strain CDC1551 (74 aa), FASTA scores: opt: 142, E(): 0.0016, (48.85% identity in 43 aa overlap); AAK46916|MT2606 hypothetical 8.0 KDA protein from strain CDC1551 (74 aa), FASTA scores: opt: 139, E(): 0.0026, (37.2% identity in 78 aa overlap); O50456|Rv1241|MTV006.13 hypothetical 9.9 KDA protein from strain H37Rv (86 aa), FASTA scores: opt: 134, E(): 0.0066, (39.0% identity in 82 aa overlap); etc.
Functional category-
TranscriptomicsmRNA level (identified by real-time quantitative RT-PCR) increased 24 and 72h after cultured macrophages infection (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS37080743708316-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3321c|vapB44
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV