Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3351c, (MTV004.08c), len: 264 aa. Hypothetical protein, highly similar to C-terminal region (aa 292-479) of O53608|Rv0063|MTV030.06 oxidoreductase from Mycobacterium tuberculosis (479 aa), FASTA scores: opt: 699, E(): 1.7e-36, (54.75% identity in 190 aa overlap). Shows some similarity to Q9KYD6|SCD72A.20 putative lipoprotein (fragment) from Streptomyces coelicolor (403 aa), FASTA scores: opt: 192, E(): 9.1e-05, (27.9% identity in 154 aa overlap); and P71091|YGAK hypothetical 54.4 KDA protein from Bacillus subtilis (480 aa), FASTA scores: opt: 174, E(): 0.0014, (26.5% identity in 166 aa overlap). Note that the two upstream ORFs Rv3352c and Rv3353c also show similarity to Rv0063 (MTV030_7). Sequence was checked but no errors found. Predicted to be an outer membrane protein (See Song et al., 2008).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS37673463768140-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3351c|Rv3351c
VLASCPARSGAAVADAIKSAVGVQPSGVEHKTLRRMDLVRYLAGGHTTYPPEGFVAGSDVIGTTNPAAAQAIVAAIGTWPPAAGRASALIDSLGGAVGDMDPEGSAFPWCRQSAVVQWYVNTPSDGQVATANKWLSDAHHAVQHFSVGGYVNYLEANAAASQYFGANLSRLTTVRRKYDPDRIMYSGLDFSTRQVAERLLPALGFRVRFGVLVIRCALCTDTVKRLGTLPNLTWSRLKVNVAVTQEQAGVMDLPALPVRRTPRR