Gene Rv3373
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Could possibly oxidize fatty acids using specific components [catalytic activity: (3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl-CoA + H(2)O]. |
| Product | Probable enoyl-CoA hydratase EchA18 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase) |
| Comments | Rv3373, (MTV004.31), len: 213 aa. Probable echA18, enoyl-CoA hydratase, similar to others e.g. P97087|CRT from Clostridium thermosaccharolyticum (Thermoanaerobacterium thermosaccharolyticum) (259 aa), FASTA scores: opt: 423, E(): 3.4e-20, (37.95% identity in 174 aa overlap); Q9X7Q4|SC5F2A.31c from Streptomyces coelicolor (257 aa), FASTA scores: opt: 399, E(): 1.2e-18, (45.05% identity in 171 aa overlap); BAB52005|MLL5584 from Rhizobium loti (Mesorhizobium loti) (257 aa), FASTA scores: opt: 385, E(): 9.6e-18, (41.95% identity in 174 aa overlap); etc. Also some similarity to 3-hydroxybutyryl-CoA dehydratases e.g. P52046|CRT_CLOAB from Clostridium acetobutylicum (261 aa), FASTA scores: opt: 414, E(): 1.3e-19, (38.3% identity in 175 aa overlap). And similar to other hydratases from Mycobacterium tuberculosis e.g. O53418|ECH8_MYCTU|Rv1070c|MT1100|MTV017.23c probable enoyl-CoA hydratase (257 aa), FASTA scores: opt: 365, E(): 1.9e-16, (39.1% identity in 174 aa overlap). Belongs to the enoyl-CoA hydratase/isomerase family. Note that this homology extends across the stop codon and directly into the next ORF MTV004.29, suggesting a possible readthrough of the TGA stop codon. |
| Functional category | Lipid metabolism |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3787726 | 3788367 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3373|echA18
MRRRAMTKMDEASNPCGGDIEAEMCQLMREQPPAEGVVDRVALQRHRNVALITLSHPQAQNALNLASWRRLKRLLDDLAGESGLRAVVLRGAGDKAFAAGADIKEFPNTRMSAADAAEYNESLAVCLRALTTMPIPVIAAVRGLAVGGGCELATACDVCIATDDARFGIPLGKLGVTTGFTEADTVARLIGPAALKYLLFSGELIGIEEAARW
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
