Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCould possibly oxidize fatty acids using specific components [catalytic activity: (3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl-CoA + H(2)O].
ProductProbable enoyl-CoA hydratase EchA18 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)
CommentsRv3373, (MTV004.31), len: 213 aa. Probable echA18, enoyl-CoA hydratase, similar to others e.g. P97087|CRT from Clostridium thermosaccharolyticum (Thermoanaerobacterium thermosaccharolyticum) (259 aa), FASTA scores: opt: 423, E(): 3.4e-20, (37.95% identity in 174 aa overlap); Q9X7Q4|SC5F2A.31c from Streptomyces coelicolor (257 aa), FASTA scores: opt: 399, E(): 1.2e-18, (45.05% identity in 171 aa overlap); BAB52005|MLL5584 from Rhizobium loti (Mesorhizobium loti) (257 aa), FASTA scores: opt: 385, E(): 9.6e-18, (41.95% identity in 174 aa overlap); etc. Also some similarity to 3-hydroxybutyryl-CoA dehydratases e.g. P52046|CRT_CLOAB from Clostridium acetobutylicum (261 aa), FASTA scores: opt: 414, E(): 1.3e-19, (38.3% identity in 175 aa overlap). And similar to other hydratases from Mycobacterium tuberculosis e.g. O53418|ECH8_MYCTU|Rv1070c|MT1100|MTV017.23c probable enoyl-CoA hydratase (257 aa), FASTA scores: opt: 365, E(): 1.9e-16, (39.1% identity in 174 aa overlap). Belongs to the enoyl-CoA hydratase/isomerase family. Note that this homology extends across the stop codon and directly into the next ORF MTV004.29, suggesting a possible readthrough of the TGA stop codon.
Functional categoryLipid metabolism
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS37877263788367+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3373|echA18
MRRRAMTKMDEASNPCGGDIEAEMCQLMREQPPAEGVVDRVALQRHRNVALITLSHPQAQNALNLASWRRLKRLLDDLAGESGLRAVVLRGAGDKAFAAGADIKEFPNTRMSAADAAEYNESLAVCLRALTTMPIPVIAAVRGLAVGGGCELATACDVCIATDDARFGIPLGKLGVTTGFTEADTVARLIGPAALKYLLFSGELIGIEEAARW