Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved lipoprotein LpqD
CommentsRv3390, (MTV004.48), len: 236 aa. Probable lpqD, a conserved lipoprotein with some similarity to various bacterial proteins e.g. Q9F3Q7|SC10F4.03 putative isomerase from Streptomyces coelicolor (224 aa), FASTA scores: opt: 416, E(): 2.5e-18, (33.0% identity in 197 aa overlap); Q9ZAX0|PGM 2,3-PDG dependent phosphoglycerate mutase from Amycolatopsis methanolica (205 aa), FASTA scores: opt: 314, E(): 3.7e-12, (28.55% identity in 203 aa overlap); P73454|SLR1748 hypothetical 24.2 KDA protein from Synechocystis sp. strain PCC 6803 (214 aa), FASTA scores: opt: 201, E(): 2.8e-05, (23.8% identity in 189 aa overlap); etc. Also similar to Mycobacterium tuberculosis hypothetical proteins e.g. O53817|Rv0754|MTV041.28 PGRS-family protein (584 aa), FASTA scores: opt: 219, E(): 5.1e-06, (39.8% identity in 226 aa overlap). Contains signal sequence and appropriately positioned PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
Functional categoryCell wall and cell processes
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS; predicted transmembrane protein (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 1-DGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis and possibly down-regulated by hrcA|Rv2374c (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38048653805575+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3390|lpqD
MAKRTPVRKACTVLAVLAATLLLGACGGPTQPRSITLTFIRNAQSQANADGIIDTDMPGSGLSADGKAEAQQVAHQVSRRDVDSIYSSPMAADQQTAGPLAGELGKQVEILPGLQAINAGWFNGKPESMANSTYMLAPADWLAGDVHNTIPGSISGTEFNSQFSAAVRKIYDSGHNTPVVFSQGVAIMIWTLMNARNSRDSLLTTHPLPNIGRVVITGNPVTGWRLVEWDGIRNFT
      
Bibliography