Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionHas cyclopropane function. Transfers a methylene group from S-adenosyl-L-methionine to the cis double bond of an unsaturated fatty acid chain resulting in the replacement of the double bond with a methylene bridge. Mycolic acids, which represent the major constituent of mycobacterial cell wall complex, act as substrates [catalytic activity: S-adenosyl-L-methionine + phospholipidolefinic fatty acid = S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid].
ProductCyclopropane-fatty-acyl-phospholipid synthase 1 CmaA1 (cyclopropane fatty acid synthase) (CFA synthase) (cyclopropane mycolic acid synthase 1)
CommentsRv3392c, (MTV004.50), len: 287 aa. CmaA1, cyclopropane mycolic acid synthase 1, characterized in 1995 as CFA1_MYCTU|Q11195|CMAA1|CMA1 cyclopropane-fatty-acyl-phospholipid synthase 1 (see citations below). Highly similar to Mycobacterium tuberculosis proteins MTCY20H10.23c (58.7% identity in 286 aa overlap); MTCY20H10.24c (68.6% identity); MTCY20H10.25c (73.5% identity); MTCY20H10.26c (57.0% identity); and MTCY20G9.30c (55.7% identity). Also highly similar to Q9CBK3|MMAA4|ML1903 methyl mycolic acid synthases from Mycobacterium leprae (298 aa), FASTA scores: opt: 1098, E(): 1e-63, (57.0% identity in 286 aa overlap). Equivalent to AAK44898|MT0672 from Mycobacterium tuberculosis strain CDC1551 (317 aa) but shorter 30 aa and with some differences in residues between the proteins.
Functional categoryLipid metabolism
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38075743808437-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3392c|cmaA1
MPDELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK
      
Bibliography