Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in the binding of fMet-tRNA and, hence, in the initiation of translation.
Product30S ribosomal protein S13 RpsM
CommentsRv3460c, (MTCY13E12.13c), len: 124 aa. rpsM, 30S ribosomal protein S13, equivalent to Q9X7A1|RS13_MYCLE|RPSM|ML1960|MLCB1222.30c 30S ribosomal protein S13 from Mycobacterium leprae (124 aa), FASTA scores: opt: 762, E(): 1.5e-43, (92.75% identity in 124 aa overlap); and P45813|RS13_MYCBO|RPSM from Mycobacterium bovis (123 aa), FASTA scores: opt: 727, E(): 3e-41, (98.25% identity in 114 aa overlap). Also highly similar to others e.g. O86773|RS13_STRCO|SC6G4.05 from Streptomyces coelicolor (126 aa), FASTA scores: opt: 631, E(): 6.2e-35, (73.75% identity in 122 aa overlap); Q9RA65|RPS13 from Thermus aquaticus (subsp. thermophilus) (126 aa), FASTA scores: opt: 552, E(): 9.8e-30, (62.6% identity in 123 aa overlap); P20282|RS13_BACSU|RPSM from Bacillus subtilis (120 aa), FASTA scores: opt: 533, E(): 1.7e-28, (64245% identity in 121 aa overlap); etc. Contains ribosomal protein S13 signature (PS00646). Belongs to the S13P family of ribosomal proteins.
Functional categoryInformation pathways
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using CEGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 96h of starvation (see citation below). DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38796963880070-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3460c|rpsM
MARLVGVDLPRDKRMEVALTYIFGIGRTRSNEILAATGIDRDLRTRDLTEEQLIHLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGMPVRGQRTKTNARTRKGPKRTIAGKKKAR
      
Bibliography