Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in translation mechanism.
Product50S ribosomal protein L36 RpmJ
CommentsRv3461c, (MTCY13E12.14c), len: 37 aa. rpmJ, 50S ribosomal protein L36, equivalent to P45810|RL36_MYCBO|RPMJ from Mycobacterium bovis (37 aa); and Q9X7A2|RL36_MYCLE|RPMJ|ML1961|MLCB1222.31c 50S ribosomal protein L36 from Mycobacterium leprae (37 aa), FASTA scores: opt: 241, E(): 9.7e-14, (86.5% identity in 37 aa overlap). Also highly similar to others e.g. O86772|RL36_STRCO|SC6G4.04 from Streptomyces coelicolor (37 aa), FASTA scores: opt: 233, E(): 4.5e-13, (83.8% identity in 37 aa overlap); P07841|RL36_BACST|RPMJ from Bacillus stearothermophilus (37 aa), FASTA scores: opt: 214, E(): 1.6e-11, (72.95% identity in 37 aa overlap); P12230|RK36_SPIOL|RPL36 from Spinacia oleracea (Spinach) (37 aa), FASTA scores: opt: 211, E(): 2.9e-11, (70.25% identity in 37 aa overlap); etc. Contains PS00828 Ribosomal protein L36 signature. Belongs to the L36P family of ribosomal proteins.
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutantslow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38802863880399-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3461c|rpmJ
VKVNPSVKPICDKCRLIRRHGRVMVICSDPRHKQRQG