Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv3541c, (MTCY03C7.15), len: 129 aa. Conserved protein, showing some similarity to Q9CBJ7|ML1909 hypothetical protein from Mycobacterium leprae (142 aa) FASTA scores: opt: 110, E(): 1.2, (27.95% identity in 118 aa overlap); and other (see also blastp results) e.g. Q9L0M3|SCD82.08 hypothetical 15.2 KDA protein from Streptomyces coelicolor (142 aa), FASTA scores: opt: 127, E(): 0.086, (27.65% identity in 123 aa overlap). Contains PS00075 Dihydrofolate reductase signature.
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis; transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below).
OperonRv3540c, Rv3541c, Rv3542c, Rv3543c, Rv3544c, and Rv3545c are co-transcribed, by RT-PCR (See Chang et al., 2007).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). H37Rv Rv3540c-Rv3545c mutant is attenuated for growth in mouse macrophages and during the early stages of infection in mice (See Chang et al., 2007). M. tuberculosis H37Rv Rv3540c-Rv3545c mutant is unable to grow in minimal medium with cholesterol but can still perform initial steps of cholesterol degradation; in vitro growth defect is partially complemented by having additional mutation in yrbE4a|Rv3501c; reduced CFU of Rv3540c-Rv3545c mutant in C57BL/6 mouse lungs and spleen is complemented by having additional mutation in yrbE4a|Rv3501c (See Chang et al., 2009).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS39806593981048-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3541c|Rv3541c
MTVVGAVLPELKLYGDPTFIVSTALATRDFQDVHHDRDKAVAQGSKDIFVNILTDTGLVQRYVTDWAGPSALIKSIGLRLGVPWYAYDTVTFSGEVTAVNDGLITVKVVGRNTLGDHVTATVELSMRDS
      
Bibliography