Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible conserved lipoprotein LpqE
CommentsRv3584, (MTV024.02), len: 182 aa. Possible lpqE, conserved lipoprotein, equivalent to Q9ZBM7|MLCB1450.02|LPQE|ML0319 putative lipoprotein from Mycobacterium leprae (183 aa), FASTA scores: opt: 722, E(): 6.2e-37, (63.45% identity in 175 aa overlap). Also similar in part to Q9KK69 exported protein 996A010 (fragment) from Mycobacterium avium (41 aa), FASTA scores: opt: 180, E(): 0.00012, (69.25% identity in 39 aa overlap); and Q9L0R0|SCD8A.04c putative lipoprotein from Streptomyces coelicolor (241 aa), FASTA scores: opt: 127, E(): 0.86, (27.15% identity in 173 aa overlap). Equivalent to AAK48048 from Mycobacterium tuberculosis strain CDC1551 (238 aa) but shorter 56 aa. Contains probable N-terminal signal sequence and appropriately positioned PS00013 Prokaryotic membrane lipoprotein lipid attachment site. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryCell wall and cell processes
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS; predicted transmembrane protein (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Predicted surface lipoprotein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40258304026378+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3584|lpqE
VNRCNIRLRLAGMTTWVASIALLAAALSGCGAGQISQTANQKPAVNGNRLTINNVLLRDIRIQAVQTSDFIQPGKAVDLVLVAVNQSPDVSDRLVGITSDIGSVTVAGDARLPASGMLFVGTPDGQIVAPGPLPSNQAAKATVNLTKPIANGLTYNFTFKFEKAGQGSVMVPISAGLATPHE
      
Bibliography